DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sif and Arhgef9

DIOPT Version :9

Sequence 1:NP_001261446.1 Gene:sif / 43892 FlyBaseID:FBgn0085447 Length:2734 Species:Drosophila melanogaster
Sequence 2:XP_038955963.1 Gene:Arhgef9 / 66013 RGDID:620719 Length:523 Species:Rattus norvegicus


Alignment Length:409 Identity:103/409 - (25%)
Similarity:168/409 - (41%) Gaps:101/409 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1437 SSVSTTALTPS-------RQLTDAEKLR-KVVMELVDTERTYVKHLNNLLEHYLEP-MKRETFLS 1492
            |.|....|.|:       |.|.:.:::| .|:.|::.|||.|:|||.::.|.||:. .||....|
  Rat    84 SDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFS 148

  Fly  1493 NAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFKLY 1557
            :.::..:||||.:|..||..|:::||:..:     |...|       |..||..||.:.:.|.:|
  Rat   149 DEQLKVIFGNIEDIYRFQMGFVRDLEKQYN-----NDDPH-------LSEIGPCFLEHQDGFWIY 201

  Fly  1558 SSFCASHSKA----QKVLHPNEGNHALQEFLAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQM 1618
            |.:|.:|..|    .|::..:...|.   |.|.|..:|.....::.:|:.|:|:|.||||.|.::
  Rat   202 SEYCNNHLDACMELSKLMKDSRYQHF---FEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAEL 263

  Fly  1619 RNLTDTRADEHVHLCEALKGMEKVAEHINEMQR-------------------------------- 1651
            ...|.....::.::..||..|..|.:.|||.:|                                
  Rat   264 LKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGDDILDRSSELIY 328

  Fly  1652 ------IHEEYGA-------IFDHLFRQHQKSCKQPIDLSPGDLLYYGG------VEWLNI---- 1693
                  |::.||.       :|||    ....||:  ||...|:|||.|      .|.::|    
  Rat   329 TGEMAWIYQPYGRNQQRVFFLFDH----QMVLCKK--DLIRRDILYYKGRIDMDKYEVIDIEDGR 387

  Fly  1694 -SDFLGKIKKGLELH-------AMCFVFKSAVVFLCKERLRQKKKLMGVSSKNATNEVEIIRYQV 1750
             .||...:|...:||       .:.|..|...........|:::|::....|......|..:.|.
  Rat   388 DDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIGFEISENQKRQA 452

  Fly  1751 LIPVTEVQVRASSAKDMDS 1769
            .:.|.    :||..|.::|
  Rat   453 AMTVR----KASKQKGVNS 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sifNP_001261446.1 WH1 35..144 CDD:214674
PH1_Tiam1_2 860..985 CDD:269937
PH 873..974 CDD:278594
TIAM1_RBD 1141..1219 CDD:176413
PDZ_signaling 1221..1308 CDD:238492
RhoGEF 1456..1647 CDD:238091 59/196 (30%)
PH2_Tiam1_2 1650..1823 CDD:269957 35/183 (19%)
PH 1693..1812 CDD:278594 18/89 (20%)
Arhgef9XP_038955963.1 SH3_ARHGEF9 14..75 CDD:212908
RhoGEF 114..293 CDD:214619 59/193 (31%)
PH_Collybistin_ASEF 298..437 CDD:269931 26/144 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.