DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sif and AgaP_AGAP010472

DIOPT Version :9

Sequence 1:NP_001261446.1 Gene:sif / 43892 FlyBaseID:FBgn0085447 Length:2734 Species:Drosophila melanogaster
Sequence 2:XP_001689404.1 Gene:AgaP_AGAP010472 / 5668042 VectorBaseID:AGAP010472 Length:248 Species:Anopheles gambiae


Alignment Length:349 Identity:68/349 - (19%)
Similarity:106/349 - (30%) Gaps:162/349 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly  2369 SVCSSRDNSQDRLSAGRRTP----SPRRSSEGGGILKHTTGPDPGILKPPSSPAKSKSPDRSCLK 2429
            ::.::|..|.|..|:...|.    |...:...|..|.:||          :||..|.||      
Mosquito    17 TITTARTTSADISSSSSATAIATVSTNTTCLTGYQLSNTT----------NSPTSSSSP------ 65

  Fly  2430 KGGPSHVCSVETLSPRVSPRGSMDHLSPDRGMTSSSCLRHSPRSSFDSHGESDHNLDVPHGSRKR 2494
                          |..||        .||.:||:. :..:|:|             |..||...
Mosquito    66 --------------PATSP--------TDRSITSAP-ITGNPQS-------------VTSGSSSS 94

  Fly  2495 SMSAHGSFETGTRPRAQETYQYYPVYDNQTCSDHYVAAAPTGRYGGGTSSRSRLSKS---LERST 2556
            :::|                               |.::.|.|      :||.|.||   |:::|
Mosquito    95 AITA-------------------------------VVSSGTKR------TRSLLLKSTSPLQQTT 122

  Fly  2557 -SRDSTTTSSSYG----------HRAYGVSPDRNYVVFSSGPLRSQSAENTFSSQPIYDPLPR-- 2608
             |..|.|.||..|          |....|||      .::||        |||:.|..||:..  
Mosquito   123 HSSPSHTVSSPQGPPVPPRLSHIHAIGSVSP------ANTGP--------TFSNHPSIDPISTTT 173

  Fly  2609 ---------------------HPPQPLHQPPMHHQQQQQQQQQQQYMSYAPEMGGYTGCQHDPQG 2652
                                 .||.|   .|:....:.::.....:.|..|.:            
Mosquito   174 SSNASSEAIVMSSIVTGTCYVTPPTP---APLITSDKHRELPSMTFGSVTPTV------------ 223

  Fly  2653 GYQLSSSAPEYTTCIDCLYQKRPS 2676
               :|::.|:.||.....:.|.|:
Mosquito   224 ---VSNTLPDSTTLTASGHNKTPT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sifNP_001261446.1 WH1 35..144 CDD:214674
PH1_Tiam1_2 860..985 CDD:269937
PH 873..974 CDD:278594
TIAM1_RBD 1141..1219 CDD:176413
PDZ_signaling 1221..1308 CDD:238492
RhoGEF 1456..1647 CDD:238091
PH2_Tiam1_2 1650..1823 CDD:269957
PH 1693..1812 CDD:278594
AgaP_AGAP010472XP_001689404.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.