DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sif and PLEK

DIOPT Version :9

Sequence 1:NP_001261446.1 Gene:sif / 43892 FlyBaseID:FBgn0085447 Length:2734 Species:Drosophila melanogaster
Sequence 2:NP_002655.2 Gene:PLEK / 5341 HGNCID:9070 Length:350 Species:Homo sapiens


Alignment Length:148 Identity:39/148 - (26%)
Similarity:60/148 - (40%) Gaps:35/148 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   886 KRG-----WKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDGA-IMQPIPEHPKRDYIFCL 944
            |:|     ||..||.|....:.||.      :..:.:||.:|.:.|: :..|..:..||.::|.:
Human    13 KKGSVFNTWKPMWVVLLEDGIEFYK------KKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFKI 71

  Fly   945 STAFGDAYLFQAPCQVELENWVNSIHSA--C---AAAFARHRGK----------TGTLHLLQEEI 994
            :|.....:.|||....|.:.||..|..|  |   ...|||...:          .|.|:|..:: 
Human    72 TTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKD- 135

  Fly   995 FRLEKAI-----ESDHKL 1007
              .||.|     |.|.|:
Human   136 --TEKGIKELNLEKDKKI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sifNP_001261446.1 WH1 35..144 CDD:214674
PH1_Tiam1_2 860..985 CDD:269937 30/119 (25%)
PH 873..974 CDD:278594 27/98 (28%)
TIAM1_RBD 1141..1219 CDD:176413
PDZ_signaling 1221..1308 CDD:238492
RhoGEF 1456..1647 CDD:238091
PH2_Tiam1_2 1650..1823 CDD:269957
PH 1693..1812 CDD:278594
PLEKNP_002655.2 PH1_Pleckstrin_2 3..110 CDD:270113 27/102 (26%)
PH 6..101 CDD:278594 26/93 (28%)
DEP_PLEK1 125..223 CDD:239892 9/30 (30%)
PH2_Pleckstrin_2 239..346 CDD:270114
PH 245..347 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.