DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sif and si:dkey-172h23.2

DIOPT Version :9

Sequence 1:NP_001261446.1 Gene:sif / 43892 FlyBaseID:FBgn0085447 Length:2734 Species:Drosophila melanogaster
Sequence 2:NP_957093.1 Gene:si:dkey-172h23.2 / 393772 ZFINID:ZDB-GENE-141212-258 Length:221 Species:Danio rerio


Alignment Length:167 Identity:36/167 - (21%)
Similarity:62/167 - (37%) Gaps:52/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   953 LFQAPCQVELENWVNSIHSACAAAFARHR------------GKTGTLHLLQEE--IFRLEKAIES 1003
            ||....|..:.:.:...|:...|....|.            |..|.:|.|..|  :|..:.|.: 
Zfish    38 LFSGSVQTHITSTLKVNHATLQAVCPAHNCCESVLVTLFSTGPDGLVHSLATEPLVFVQDLAFD- 101

  Fly  1004 DHKLKHMAE-----------LQQSVVTDQETRHQIQTQILQWEENLERLHCEQFRLRCYMASLQS 1057
                  ||:           |:::::.|:   |||..|           .||:..|...:| |:.
Zfish   102 ------MAQFLVSAVGQTGILEEALLLDE---HQIPLQ-----------ECEKLDLSLSLA-LKH 145

  Fly  1058 GELPNPKSLLTHVSR--PTKNTLN---KLGVFTVSSF 1089
            ..||...||:.:.:|  |.:..|:   :.|:..|:.|
Zfish   146 LTLPPGWSLIGNNTRMDPQETLLHFAARRGLSKVARF 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sifNP_001261446.1 WH1 35..144 CDD:214674
PH1_Tiam1_2 860..985 CDD:269937 7/43 (16%)
PH 873..974 CDD:278594 4/20 (20%)
TIAM1_RBD 1141..1219 CDD:176413
PDZ_signaling 1221..1308 CDD:238492
RhoGEF 1456..1647 CDD:238091
PH2_Tiam1_2 1650..1823 CDD:269957
PH 1693..1812 CDD:278594
si:dkey-172h23.2NP_957093.1 ANK repeat 163..197 CDD:293786 5/20 (25%)
ANK <165..218 CDD:238125 4/18 (22%)
Ank_4 166..219 CDD:290365 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.