DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sif and pex13

DIOPT Version :9

Sequence 1:NP_001261446.1 Gene:sif / 43892 FlyBaseID:FBgn0085447 Length:2734 Species:Drosophila melanogaster
Sequence 2:NP_593611.1 Gene:pex13 / 2543046 PomBaseID:SPAC3C7.10 Length:288 Species:Schizosaccharomyces pombe


Alignment Length:76 Identity:21/76 - (27%)
Similarity:35/76 - (46%) Gaps:16/76 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1485 MKRETFLSNAE--------INALFGNIHEIVTFQRQFLQ-----NLEESLDLEPD-FNKFEHCGQ 1535
            |...||:|.:|        |.|:||.:..:...:|..|:     .::|....|.| |.|.|  |.
pombe   111 MSYNTFVSVSENLNKLKSSIGAIFGIVSLLSRLKRLVLKFFKHSKIDEMNSQEYDVFEKEE--GN 173

  Fly  1536 FRNVLFAIGSA 1546
            .:|.:::|.|:
pombe   174 HKNSIYSIVSS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sifNP_001261446.1 WH1 35..144 CDD:214674
PH1_Tiam1_2 860..985 CDD:269937
PH 873..974 CDD:278594
TIAM1_RBD 1141..1219 CDD:176413
PDZ_signaling 1221..1308 CDD:238492
RhoGEF 1456..1647 CDD:238091 21/76 (28%)
PH2_Tiam1_2 1650..1823 CDD:269957
PH 1693..1812 CDD:278594
pex13NP_593611.1 Peroxin-13_N 86..202 CDD:282008 21/76 (28%)
SH3_Pex13p_fungal 226..285 CDD:212705
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.