powered by:
Protein Alignment sif and pex13
DIOPT Version :9
Sequence 1: | NP_001261446.1 |
Gene: | sif / 43892 |
FlyBaseID: | FBgn0085447 |
Length: | 2734 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_593611.1 |
Gene: | pex13 / 2543046 |
PomBaseID: | SPAC3C7.10 |
Length: | 288 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 76 |
Identity: | 21/76 - (27%) |
Similarity: | 35/76 - (46%) |
Gaps: | 16/76 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1485 MKRETFLSNAE--------INALFGNIHEIVTFQRQFLQ-----NLEESLDLEPD-FNKFEHCGQ 1535
|...||:|.:| |.|:||.:..:...:|..|: .::|....|.| |.|.| |.
pombe 111 MSYNTFVSVSENLNKLKSSIGAIFGIVSLLSRLKRLVLKFFKHSKIDEMNSQEYDVFEKEE--GN 173
Fly 1536 FRNVLFAIGSA 1546
.:|.:::|.|:
pombe 174 HKNSIYSIVSS 184
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1291 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.