DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sif and prex2

DIOPT Version :9

Sequence 1:NP_001261446.1 Gene:sif / 43892 FlyBaseID:FBgn0085447 Length:2734 Species:Drosophila melanogaster
Sequence 2:XP_031759716.1 Gene:prex2 / 100490424 XenbaseID:XB-GENE-6048678 Length:1603 Species:Xenopus tropicalis


Alignment Length:477 Identity:114/477 - (23%)
Similarity:205/477 - (42%) Gaps:80/477 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1459 VVMELVDTERTYVKHLNNLLEHYLEPM------KRETFLSNAEINALFGNIHEIVTFQRQFLQNL 1517
            |:.||:.|||.||..|..|:..:...|      |.:..::...:..||.||.:|:...::||..:
 Frog    24 VLSELLKTERDYVGTLEFLVSAFFHRMMQYAALKADKNVTEETVKILFSNIEDILAVHKEFLSLI 88

  Fly  1518 EESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNHALQE 1582
            |:.|..||            |.|..:|:.||.:...|.:|..:|::|.||||:|........::.
 Frog    89 EDCLYPEP------------NALQEVGNCFLRFKERFAIYDEYCSNHEKAQKLLLEINKIRTVRT 141

  Fly  1583 FL---AARNPKQQHSSTLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHLCEALKGMEKVAE 1644
            ||   .....::.....||.||:.|||||.||||||:::...|..:..::|.:.:||:.|:.|..
 Frog   142 FLLNCMLLGGRKNTDVPLEGYLVAPIQRICKYPLLLRELLKRTPKKHSDYVCVVDALQAMKAVCT 206

  Fly  1645 HINEMQRIHEEYGAIFDHLFRQHQKSCK-QPIDLSPGDLLYYGGVEWLNISDFLGKIKKGLELHA 1708
            :|||.:|..|:...:.:  ::.|.:..: ..|..:..::|.:|         .|.||..|.....
 Frog   207 NINEAKRQMEKLEVLEE--WQSHIEGWEGSSITDTCTEMLMHG---------VLLKISSGNIQDR 260

  Fly  1709 MCFVFKSAVVFLCKERLRQKKKLMGVSSKNATN-EVEIIRYQVLIPVTEVQVRASSAKDMDSHFL 1772
            :.|:|.:.:|: ||.:.|:.|     ::|.:|: ...|.|.::...|.||:.......|..|...
 Frog   261 VFFLFDNLLVY-CKRKQRRLK-----NNKASTDGHRYIFRGRINTEVMEVENVDDGTADFHSSGN 319

  Fly  1773 -----WELIHLRSQLQRRSEKVYVLSNSTADFRNAFLKTIRQIIRESVRNMSIPMKNFGGSSGSV 1832
                 |: ||     .....|.:|....|.:.:..:|:.   |::|..|..|:   ..|....:.
 Frog   320 TVVNGWK-IH-----NTAKNKWFVCMAKTPEDKQEWLEA---ILKERERRKSL---RLGMEQDTW 372

  Fly  1833 SGHSSQGMGSMGYPGNSQTLERPKQQITIVHGSHTLGKPKKKSGSQRHSAGN------IDYDNLS 1891
            ...|.||              ....::...||:....:.||.:...:...|:      ::...:.
 Frog   373 MMISEQG--------------EKLYKMMCKHGNLIKDRKKKLTSFPKCFIGSEFVDWLLEIGEIH 423

  Fly  1892 GSQEADDLPPSV---GVVHYAS 1910
            ..:|..:|..::   |::|:.|
 Frog   424 KQEEGVNLGQALLENGIIHHVS 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sifNP_001261446.1 WH1 35..144 CDD:214674
PH1_Tiam1_2 860..985 CDD:269937
PH 873..974 CDD:278594
TIAM1_RBD 1141..1219 CDD:176413
PDZ_signaling 1221..1308 CDD:238492
RhoGEF 1456..1647 CDD:238091 60/196 (31%)
PH2_Tiam1_2 1650..1823 CDD:269957 37/179 (21%)
PH 1693..1812 CDD:278594 28/124 (23%)
prex2XP_031759716.1 RhoGEF 24..209 CDD:395496 60/196 (31%)
PH_Collybistin_ASEF 215..362 CDD:269931 35/172 (20%)
DEP 379..459 CDD:413322 11/81 (14%)
DEP_2_P-Rex 471..563 CDD:239887
PDZ 672..740 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.