DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and Fgfr3

DIOPT Version :9

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:XP_006251452.1 Gene:Fgfr3 / 84489 RGDID:620714 Length:804 Species:Rattus norvegicus


Alignment Length:436 Identity:168/436 - (38%)
Similarity:237/436 - (54%) Gaps:69/436 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 LFVLLL----LCLLIAQRKMLQRRLGKQSMTTSSKQALP-------ESGGGDFALMPLQSGFRFE 758
            ||:|::    ||.|   |...::.||..::...|:..|.       ||.....:..||....|..
  Rat   381 LFILVVAAVTLCRL---RSPPKKGLGSPTVHKVSRFPLKRQVTVSLESNSSMNSNTPLVRIARLS 442

  Fly   759 SG---------------DAKWEFPREKLQLDTVLGEGEFGQVLK----GFATEIAGLPGITTVAV 804
            ||               |.|||..|.:|.|...||||.||||:.    |...:....|  .||||
  Rat   443 SGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKP--VTVAV 505

  Fly   805 KMLKKGSNSVEYMALLSEFQLLQEV-SHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSRK 868
            ||||..:...:...|:||.::::.: .|.|:|.||||||......:::|||..|:||.:||..|.
  Rat   506 KMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRP 570

  Fly   869 IECAGVDFADGV-----EPVNVKMVLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKIS 928
               .|:|::...     |.:..|.:::.|:|:.:||.||:..|.:||||||||||:.:..:.||:
  Rat   571 ---PGMDYSFDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIA 632

  Fly   929 DFGLTRDVYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIA 993
            ||||.|||:..|.|.|.:..|:||||||||:|.|.|||.:|||||||||.||:.|||.||||||.
  Rat   633 DFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIP 697

  Fly   994 PQNLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASEFEKLL--GNNAKYIDL- 1055
            .:.|:.|||.|:|||:|.||:..:|.|:|.||...|:.||:||.|..:.:::|  .:..:|:|| 
  Rat   698 VEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLS 762

  Fly  1056 -----------ETNAVSNPLYCGDDSALITTELGEPESLQHLWSPP 1090
                       :|.:.|:   .|||| :.|.:|..|       .||
  Rat   763 VPFEQYSPGGQDTPSSSS---SGDDS-VFTHDLLPP-------GPP 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 PKc_like 770..1049 CDD:304357 131/290 (45%)
TyrKc 771..1042 CDD:197581 130/280 (46%)
Fgfr3XP_006251452.1 IGc2 51..108 CDD:197706
IG 52..123 CDD:214652
Ig2_FGFR 155..239 CDD:143265
IG_like 254..349 CDD:214653
Ig3_FGFR 262..350 CDD:143175
PTKc_FGFR3 457..790 CDD:173652 146/341 (43%)
Pkinase_Tyr 470..746 CDD:285015 130/280 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.