DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and TIE1

DIOPT Version :9

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_005415.1 Gene:TIE1 / 7075 HGNCID:11809 Length:1138 Species:Homo sapiens


Alignment Length:438 Identity:149/438 - (34%)
Similarity:228/438 - (52%) Gaps:55/438 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 NETEAEPLLG--------VRRGTPPNQPLQDPMLLGVLNVAGFECDRSCMFFVITCPLLFVLLLL 711
            :.|..|..||        |:......:.|...::|.|:......|            |..:..||
Human   729 SNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATC------------LTILAALL 781

  Fly   712 CLLIAQRKMLQRRLGKQSMTTSSKQALPESGGGDFALMPLQSGFRFESGDAKWE-----FP---R 768
            .|:..:|..|.||   ::.|.       :||.|:..::...||....:...|.:     :|   .
Human   782 TLVCIRRSCLHRR---RTFTY-------QSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEW 836

  Fly   769 EKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLLQEVS-HP 832
            |.:..:.::|||.||||::....: .||.  ...|:||||:.::..::.....|.::|.::. ||
Human   837 EDITFEDLIGEGNFGQVIRAMIKK-DGLK--MNAAIKMLKEYASENDHRDFAGELEVLCKLGHHP 898

  Fly   833 NVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSRKIECAGVDFADGVE-----PVNVKMVLTFA 892
            |:|.|||||.:.....:.||||.||:|..:||.||.:|   .|.|...|     .::.:.:|.||
Human   899 NIINLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLE---TDPAFAREHGTASTLSSRQLLRFA 960

  Fly   893 WQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWMAP 957
            .....||.||||.:.:||||||||||:.:....||:||||:|.   ::.|:|::..|:||:|||.
Human   961 SDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRG---EEVYVKKTMGRLPVRWMAI 1022

  Fly   958 ESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLLKTGYRMDRPENCSEAVYSIVR 1022
            |||...|||:||||||||||.||:::||.:||.|:....|:..|..||||::|.||.:.||.::|
Human  1023 ESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMR 1087

  Fly  1023 TCWADEPNGRPSFKFLASEFEKLLGNNAKYIDLETNAVSNPLYCGDDS 1070
            .||.|.|..||.|..:|.:..::|.....|:::  :...|..|.|.|:
Human  1088 QCWRDRPYERPPFAQIALQLGRMLEARKAYVNM--SLFENFTYAGIDA 1133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 PKc_like 770..1049 CDD:304357 118/284 (42%)
TyrKc 771..1042 CDD:197581 117/276 (42%)
TIE1NP_005415.1 ig 129..210 CDD:278476
EGF_CA 227..256 CDD:238011
EGF_2 315..344 CDD:285248
ig 356..441 CDD:278476
fn3 452..536 CDD:278470
fn3 548..632 CDD:278470
FN3 644..736 CDD:238020 2/6 (33%)
PTKc_Tie1 836..1132 CDD:270671 123/306 (40%)
TyrKc 839..1107 CDD:197581 117/276 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.