DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and LOC569566

DIOPT Version :9

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:XP_698054.5 Gene:LOC569566 / 569566 -ID:- Length:509 Species:Danio rerio


Alignment Length:295 Identity:68/295 - (23%)
Similarity:108/295 - (36%) Gaps:96/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 QRKMLQRRLGKQSMTTSSKQALPESGGGDFALMPLQSGFRFES-----GDAKWE----------F 766
            |.|.::|::.....:.:.|......|..:..|..|::|..|.|     |...||          .
Zfish   140 QPKKMRRKVHVALASKTVKFQCQAEGNPNPKLRWLKNGKEFNSDQRTGGYTLWENTWAIVMESVV 204

  Fly   767 PREKLQLDTVLGEGEFGQVLKGFATEI-----------AGLPGITTVAVKMLKKGSNSVEYMA-L 819
            |.:|... |.|.|.|:|.:...:..::           ||||...|..|     ||: ||::. :
Zfish   205 PSDKGNY-TCLVENEYGSINHTYQLDVWESSPERPILYAGLPANRTAMV-----GSD-VEFVCKV 262

  Fly   820 LSEFQ-LLQEVSHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSRKIECAGVDFADGVEPV 883
            :::.| .:|.:.|   |::.|   |.|.|                              ||:..|
Zfish   263 INDSQSYIQWIKH---IRVNG---SQEGP------------------------------DGIPYV 291

  Fly   884 NVKMVLTFAWQICKGMAYLS----ELKLVHRDLAARNVLLAD-GKICKISDFGLTRDVYEDDAYL 943
            .|..           ||.||    |:::|   |..|||.|.| |:...:.|..:  .:....|:|
Zfish   292 RVLK-----------MADLSTTDKEIEVV---LQLRNVSLEDAGQYTCLVDNSI--GISHKSAWL 340

  Fly   944 KRSRDRVPVKWMAPESLADH--VYTSKSD--VWSF 974
            ...:|..||.....:|:..|  |.|::.|  .|.|
Zfish   341 TVVKDAEPVSVKEGDSVTLHTGVKTNQQDDVKWYF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 PKc_like 770..1049 CDD:304357 54/227 (24%)
TyrKc 771..1042 CDD:197581 53/226 (23%)
LOC569566XP_698054.5 Ig 36..121 CDD:299845
I-set 139..230 CDD:254352 20/90 (22%)
Ig 146..230 CDD:299845 18/84 (21%)
IG_like 245..342 CDD:214653 35/154 (23%)
Ig 253..342 CDD:299845 32/141 (23%)
IG_like 347..442 CDD:214653 9/29 (31%)
Ig 354..441 CDD:299845 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.