DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and Src64B

DIOPT Version :10

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster


Alignment Length:286 Identity:107/286 - (37%)
Similarity:154/286 - (53%) Gaps:29/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   763 KWEFPREKLQLDTVLGEGEFGQVLKG-FATEIAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLL 826
            |:|.||.::||...||.|.||:|..| :...|       .||||.|::|:.|.  .|.|.|..::
  Fly   277 KYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSI-------DVAVKTLREGTMST--AAFLQEAAIM 332

  Fly   827 QEVSHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSRKIECAG--VDFADGVEPVNVKMVL 889
            ::..|..::.|...|:..|...::.||...|||..:||     |..|  :.|.|         ::
  Fly   333 KKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLR-----EGDGRYLHFED---------LI 383

  Fly   890 TFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKW 954
            ..|.|:..||.||...:|:||||||||||:.:..:.||.||||.| |..||.|..:...|.||||
  Fly   384 YIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLAR-VIADDEYCPKQGSRFPVKW 447

  Fly   955 MAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLLKTGYRMDRPEN--CSEAV 1017
            .|||::....::.||||||:|:|..||.|.|..||||:..:.:...::.|:||.:|.|  ..:.:
  Fly   448 TAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNI 512

  Fly  1018 YSIVRTCWADEPNGRPSFKFLASEFE 1043
            |.::..||...|..||:|:||...||
  Fly   513 YQLLLQCWDAVPEKRPTFEFLNHYFE 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 Protein Kinases, catalytic domain 770..1049 CDD:473864 103/279 (37%)
Src64BNP_001286937.1 SH2_Src_family 158..259 CDD:199827
PTKc_Src_like 289..538 CDD:270630 99/272 (36%)
SH3_Src_like 99..150 CDD:212779
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.