DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and InR

DIOPT Version :9

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster


Alignment Length:484 Identity:146/484 - (30%)
Similarity:227/484 - (46%) Gaps:83/484 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   697 FFVITCPLLFVLLLL----CLLIAQRKMLQRRLGKQSMTT------SSKQALPESGGGDFALMPL 751
            |:::...|.|:::.|    |.| .:||:....|   .|.|      :|.|.:|:.          
  Fly  1313 FWLLGIGLAFLIVSLFGYVCYL-HKRKVPSNDL---HMNTEVNPFYASMQYIPDD---------- 1363

  Fly   752 QSGFRFESGDAKWEFPREKLQLDTVLGEGEFGQVLKGFATEIAGLP--GI-TTVAVKMLKKGSNS 813
                        ||..||.:.....||:|.||.|.:|.   :...|  |: ...|:|.:.:.:..
  Fly  1364 ------------WEVLRENIIQLAPLGQGSFGMVYEGI---LKSFPPNGVDRECAIKTVNENATD 1413

  Fly   814 VEYMALLSEFQLLQEVSHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSRKIE-------- 870
            .|....|||..:::|....:|::|||.|:..:..|:::|..:.|.|:||||..|..|        
  Fly  1414 RERTNFLSEASVMKEFDTYHVVRLLGVCSRGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTY 1478

  Fly   871 CAGVDFADGVEPVNVKMVLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRD 935
            ...:.....|:|.....:...|.:|..|||||:..|.|||||||||.::||....||.|||:|||
  Fly  1479 LNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRD 1543

  Fly   936 VYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSL 1000
            :||.|.|.|.::..:||:||.||||.|.||:|.|||:||||:.||:.||.|.||.|::.:.:...
  Fly  1544 IYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRY 1608

  Fly  1001 LKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASEFEKLLGNNA-KYIDL--------- 1055
            :..|..|:|||||.:.::.:::.||....:.||||..:.:..|....|:. |.:..         
  Fly  1609 VIDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHSEAGLQH 1673

  Fly  1056 ------ETNAVSNPLYCGDDSALI--TTELGEPESLQHLWSPPKIAYDIHDQATSYDQSEEEMPV 1112
                  |.|.:       |..|.:  ..:|.:.|..:...:|.::.  .:.|.:|.||..|. |:
  Fly  1674 REKERKERNQL-------DAFAAVPLDQDLQDREQQEDATTPLRMG--DYQQNSSLDQPPES-PI 1728

  Fly  1113 TSTAPPGYDLPRPL-----LDATANGQVL 1136
            ......|..||..|     ..:|.:||.:
  Fly  1729 AMVDDQGSHLPFSLPSGFIASSTPDGQTV 1757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 PKc_like 770..1049 CDD:304357 106/289 (37%)
TyrKc 771..1042 CDD:197581 105/281 (37%)
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020
PTKc_InsR_like 1364..1652 CDD:173625 109/290 (38%)
Pkinase_Tyr 1371..1650 CDD:285015 105/281 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.