DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and htl

DIOPT Version :9

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster


Alignment Length:433 Identity:150/433 - (34%)
Similarity:230/433 - (53%) Gaps:59/433 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 SCMFFVITCPLLFVLL-LLCLLIAQRKMLQRRLGKQSMTTS---SKQAL---PESGGG-----DF 746
            |.::..:...|:|:.: .|.:..|.|||...::.||.:.|.   :|:.:   ||.||.     |.
  Fly   309 SFVYIFVFGGLIFIFMTTLFVFYAIRKMKHEKVLKQRIETVHQWTKKVIIFKPEGGGDSSGSMDT 373

  Fly   747 ALMP-----------LQSG--------FRFESGDAKWEFPREKLQLDTVLGEGEFGQVLKGFATE 792
            .:||           ||:|        :.|.. |:.||.||..|.|...||||.||:|:......
  Fly   374 MIMPVVRIQKQRTTVLQNGNEPAPFNEYEFPL-DSNWELPRSHLVLGATLGEGAFGRVVMAEVNN 437

  Fly   793 IAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLLQEVS-HPNVIKLLGACTSSEAPLLIIEYARY 856
                   ..|||||:|:|....:..:|:.|.::::.:. |.|:|.|||.|:.:....:|:|||.:
  Fly   438 -------AIVAVKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPH 495

  Fly   857 GSLRSYLRLSRKIECAGVD-FADGVEP--------VNVKMVLTFAWQICKGMAYLSELKLVHRDL 912
            |:|:.:|..:|..   |.| ..|..:|        :..|.::.||.||.:||.||:..:.:||||
  Fly   496 GNLKDFLYKNRPF---GRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDL 557

  Fly   913 AARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVL 977
            ||||||::|..:.||:||||.||:...|.|.|.:..|:|:||||||||.:..|.|||||||:|:|
  Fly   558 AARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGIL 622

  Fly   978 CWELITLGASPYPGI-APQNLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASE 1041
            .||::|.|..|||.| :.:.|::.|.:|.||::|..||..:|.::|.||....:.||.|..:...
  Fly   623 LWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEY 687

  Fly  1042 FEKLLGNNAKYIDLETNAVSNPLYCGDDSALITTELGEPESLQ 1084
            .:|||.....|:|::...:..|....|:      |..|.::||
  Fly   688 MDKLLQTKEDYLDVDIANLDTPPSTSDE------EEDETDNLQ 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 PKc_like 770..1049 CDD:304357 114/289 (39%)
TyrKc 771..1042 CDD:197581 111/281 (40%)
htlNP_524394.2 Ig 112..191 CDD:299845
IG_like 113..191 CDD:214653
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357 117/298 (39%)
STYKc 416..688 CDD:214568 111/281 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455227
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.