DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and KIT

DIOPT Version :9

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001372213.1 Gene:KIT / 3815 HGNCID:6342 Length:977 Species:Homo sapiens


Alignment Length:1035 Identity:262/1035 - (25%)
Similarity:395/1035 - (38%) Gaps:319/1035 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 YTIAESHGPYRRKDF-FEP-----VLIGALNSRAAKYLCPHVSLEY-SLNAGSSHFVLKQNRLYT 207
            |::....|....||. |.|     ::|.:: .||...||.|.|::. ..:..|..|:||....:.
Human   146 YSLKGCQGKPLPKDLRFIPDPKAGIMIKSV-KRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFK 209

  Fly   208 RQTLDHDELNGLNAKAGQLQARITCTVK-LSSRDQRKFSRILDIKLLDRNDNGPKLQESSSKF-- 269
            ...:..........:.|: :..:|||:| :||.....:.|        .|....||||..:.:  
Human   210 AVPVVSVSKASYLLREGE-EFTVTCTIKDVSSSVYSTWKR--------ENSQQTKLQEKYNSWHH 265

  Fly   270 -DFYLEQPYFQADEEAGKKVIYVDKDTLEANAHLVYAVHNDSHGLFRPDCHAYEADHTGRPHTIV 333
             ||..|:                     :|...:..|..||| |:|.  |:|             
Human   266 GDFNYER---------------------QATLTISSARVNDS-GVFM--CYA------------- 293

  Fly   334 SCQLRFSRNGVFRETPYCVSLEARDLTIVSRVDAMSATANVCYHINLSKLHESEQELPQALPLRA 398
                    |..|.......:||..|...::....::.|..|....|:..:.|.|     |.|...
Human   294 --------NNTFGSANVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYE-----AFPKPE 345

  Fly   399 RQHRIFESEEFNGDSAGRSLSPPTVDYDKDVSVYRSAASNFRVVQPDSFLDLMRLRSIRFDIVED 463
            .|..|:         ..|:.:....||.|..:     .||.|.|   |.|.|.||:         
Human   346 HQQWIY---------MNRTFTDKWEDYPKSEN-----ESNIRYV---SELHLTRLK--------- 384

  Fly   464 KLGAFGITSTSGIVFVKNPQVLEEAPETIYFLNVTWIDQQRLSHVRVINVHLVHGRPENTSCELK 528
              |..|.|.|   ..|.|..|.......:| :|.   ..:.|::.|::|..|             
Human   385 --GTEGGTYT---FLVSNSDVNAAIAFNVY-VNT---KPEILTYDRLVNGML------------- 427

  Fly   529 VKSRSQTCAQIKYQSQCVRYCGLATGGGSCQWRGSNSAMFGTRYGSCVPESR----YCP--DHVC 587
                           |||     |.|                     .||..    :||  :..|
Human   428 ---------------QCV-----AAG---------------------FPEPTIDWYFCPGTEQRC 451

  Fly   588 D------PLEELNPMACPQDCTPAGRIVGPHSSNENKRGIYSASGTCICE---DNGKCSCAPLDE 643
            .      .::.||...     .|.|::|...|.:.:   .:..:||..|:   |.||.|.     
Human   452 SASVLPVDVQTLNSSG-----PPFGKLVVQSSIDSS---AFKHNGTVECKAYNDVGKTSA----- 503

  Fly   644 EPKMKKPRKRKNETEAEPLLGVRRGTPPNQPLQDPMLLGVLNVAGFECDRSCMFFVITCPLLFVL 708
              ......|..|:.:..|           ..|..|:|:|.:.|||..|                 
Human   504 --YFNFAFKGNNKEQIHP-----------HTLFTPLLIGFVIVAGMMC----------------- 538

  Fly   709 LLLCLLIAQRKMLQRRLGKQSMTTSSKQALPESGGGDFALM-PLQSGFRFESGDAKWEFPREKLQ 772
              :.::|...|.||:     .|.....:.:.|..|.::..: |.|..:     |.||||||.:|.
Human   539 --IIVMILTYKYLQK-----PMYEVQWKVVEEINGNNYVYIDPTQLPY-----DHKWEFPRNRLS 591

  Fly   773 LDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLLQEV-SHPNVIK 836
            ....||.|.||:|::..|..:.......||||||||..::..|..||:||.::|..: :|.|::.
Human   592 FGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVN 656

  Fly   837 LLGACTSSEAPLLIIEYARYGSLRSYLRL------------------------SRKIECAG---- 873
            ||||||.....|:|.||..||.|.::||.                        |::..|:.    
Human   657 LLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE 721

  Fly   874 -VDFADGVEPV---------------------------------NVKMVLTFAWQICKGMAYLSE 904
             :|...||..|                                 :::.:|:|::|:.||||:|:.
Human   722 YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLAS 786

  Fly   905 LKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWMAPESLADHVYTSKS 969
            ...:||||||||:||..|:|.||.||||.||:..|..|:.:...|:|||||||||:.:.|||.:|
Human   787 KNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFES 851

  Fly   970 DVWSFGVLCWELITLGASPYPGI-APQNLWSLLKTGYRMDRPENCSEAVYSIVRTCWADEPNGRP 1033
            ||||:|:..|||.:||:|||||: .....:.::|.|:||..||:....:|.|::|||..:|..||
Human   852 DVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRP 916

  Fly  1034 SFKFLASEFEKLLGNNAKYI------------------DLETNAV------SNPLYCGDD 1069
            :||.:....||.:..:..:|                  .:..|:|      |.||...||
Human   917 TFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDD 976

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 PKc_like 770..1049 CDD:304357 122/342 (36%)
TyrKc 771..1042 CDD:197581 120/334 (36%)
KITNP_001372213.1 Ig strand A 212..215 CDD:409353 0/2 (0%)
ig 216..306 CDD:395002 27/143 (19%)
Ig strand B 229..239 CDD:409353 4/9 (44%)
Ig strand C' 250..252 CDD:409353 1/1 (100%)
Ig strand D 260..263 CDD:409353 0/2 (0%)
Ig strand E 267..280 CDD:409353 4/33 (12%)
Ig strand F 287..294 CDD:409353 4/29 (14%)
Ig strand G 300..308 CDD:409353 1/7 (14%)
IgI_4_SCFR 312..412 CDD:409446 30/136 (22%)
Ig strand B 332..336 CDD:409446 0/3 (0%)
Ig strand C 346..350 CDD:409446 1/3 (33%)
Ig strand E 376..380 CDD:409446 2/3 (67%)
Ig strand F 390..395 CDD:409446 2/7 (29%)
Ig strand G 403..406 CDD:409446 0/2 (0%)
Ig 427..503 CDD:409353 23/137 (17%)
Ig strand C 438..442 CDD:409353 0/3 (0%)
Ig strand E 471..479 CDD:409353 2/7 (29%)
Ig strand F 489..494 CDD:409353 2/4 (50%)
PTKc_Kit 554..929 CDD:270682 133/379 (35%)
Important for interaction with phosphotyrosine-binding proteins 569..571 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.