DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and CG10702

DIOPT Version :9

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster


Alignment Length:219 Identity:48/219 - (21%)
Similarity:78/219 - (35%) Gaps:64/219 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 TSTSGIVFVKNPQVLEEAPETIYFLNVTWIDQQRLSHVRVINVHLVHGRPENTSCELKVKSRSQT 535
            |...|:|.:           |..|.::|.|..:||.....:.|..:|...:....:|....|.|.
  Fly    86 TDVRGLVNI-----------TEMFPHLTVIRGRRLFLNYALGVTNMHELEQLVFPKLVAIQRGQV 139

  Fly   536 CAQIKYQSQCVRYCGLATGGGSCQW------RGSNSAMF-----------GTRYGSCVPESRYCP 583
                 |...|.:.|.:    |...|      ||.|:.:.           |.....|. .:.||.
  Fly   140 -----YIGSCPKLCSI----GRVNWDLLTLTRGENNIIMVNKNCSTPVCSGCSSSHCW-SNHYCQ 194

  Fly   584 ----DHVCDPLEELNPMACPQDCTPAGRIVGPHSSNENKRGIYSASGTCIC---EDNGKC--SCA 639
                ::|.:|...:|  ||.::|      :|...:|.:     |.:...:|   .|:|.|  || 
  Fly   195 RSINENVANPKANIN--ACHEEC------LGGCKNNSS-----SPADCSVCRGLSDDGVCVKSC- 245

  Fly   640 PLDEEPKMKKPRKRKNETEAEPLL 663
            |.|   |......::..|:||.:|
  Fly   246 PKD---KYVMENYQRCYTKAECVL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 PKc_like 770..1049 CDD:304357
TyrKc 771..1042 CDD:197581
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382 19/92 (21%)
Furin-like 171..297 CDD:279142 26/114 (23%)
FU 210..258 CDD:238021 15/62 (24%)
Recep_L_domain 328..441 CDD:279382
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.