DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and Ror

DIOPT Version :9

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:363 Identity:111/363 - (30%)
Similarity:185/363 - (50%) Gaps:41/363 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 LLFVLLLLCLLIAQRKMLQRRLGKQSMTTSSKQALPESGGGDFALMPLQSGFRFESGDAK----- 763
            |:|:::...:|..:|.::  ..|.:::...:..:..::..|:..|...|...|...|:..     
  Fly   327 LIFIIIFAIILFKRRTIM--HYGMRNIHNINTPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVAL 389

  Fly   764 -------------WEFPREKLQLDTVLGEGEFGQVLKGFATEIAGLPGIT--TVAVKMLKKGSNS 813
                         ..|..:.::....||||.||:|.||...:    |..|  |||:|.||:.::.
  Fly   390 NSKLIERNTLLRINHFTLQDVEFLEELGEGAFGKVYKGQLLQ----PNKTTITVAIKALKENASV 450

  Fly   814 VEYMALLSEFQLLQEVSHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSRKIE---CAGVD 875
            ........|.:|:.::.|.|::.:||...:.|...::.||...|.|..:|..:...|   .:.::
  Fly   451 KTQQDFKREIELISDLKHQNIVCILGVVLNKEPYCMLFEYMANGDLHEFLISNSPTEGKSLSQLE 515

  Fly   876 FADGVEPVNVKMVLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDD 940
            |            |..|.||.:||.|||....|||||||||.|:.:|.:.|||||||:||:|..|
  Fly   516 F------------LQIALQISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSD 568

  Fly   941 AYLKRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLLKTGY 1005
            .|..:|:..:||:||..||:....:|::||||||||:.||:.:.|..||.|.:.|.:.:|:::..
  Fly   569 YYRVQSKSLLPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQ 633

  Fly  1006 RMDRPENCSEAVYSIVRTCWADEPNGRPSFKFLASEFE 1043
            .:..||||..||||::..||.::...||:|..:::..:
  Fly   634 LLSAPENCPTAVYSLMIECWHEQSVKRPTFTDISNRLK 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 PKc_like 770..1049 CDD:304357 100/279 (36%)
TyrKc 771..1042 CDD:197581 100/275 (36%)
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 101/284 (36%)
Pkinase_Tyr 410..670 CDD:285015 100/275 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455303
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.