DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and Btk

DIOPT Version :10

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_476745.1 Gene:Btk / 34132 FlyBaseID:FBgn0003502 Length:786 Species:Drosophila melanogaster


Alignment Length:279 Identity:95/279 - (34%)
Similarity:152/279 - (54%) Gaps:20/279 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   763 KWEFPREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKKGSNSVEYMALLSEFQLLQ 827
            |||....:|.|...||.|:||.|.:|      ...|....||||:|:|:.|.:  ..:.|.:::.
  Fly   518 KWEIHPMELMLMEELGSGQFGVVRRG------KWRGSIDTAVKMMKEGTMSED--DFIEEAKVMT 574

  Fly   828 EVSHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSRKIECAGVDFADGVEPVNVKMVLTFA 892
            ::.|||:::|.|.|:......::.||.::|||.:|||...|....           |:.::|...
  Fly   575 KLQHPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHEKTLIG-----------NMGLLLDMC 628

  Fly   893 WQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRVPVKWMAP 957
            .|:.|||.||.....:||||||||.|:....:.|::||||.|.|. ||.|......:.|:||..|
  Fly   629 IQVSKGMTYLERHNYIHRDLAARNCLVGSENVVKVADFGLARYVL-DDQYTSSGGTKFPIKWAPP 692

  Fly   958 ESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAPQNLWSLLKTGYRMDRPENCSEAVYSIVR 1022
            |.|....::||||||::|||.||:.|.|..||..:....:...::.|..:::|::|::.:|.:::
  Fly   693 EVLNYTRFSSKSDVWAYGVLMWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMK 757

  Fly  1023 TCWADEPNGRPSFKFLASE 1041
            .||:..|..||:|:.|..:
  Fly   758 LCWSHGPEERPAFRVLMDQ 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 Protein Kinases, catalytic domain 770..1049 CDD:473864 92/272 (34%)
BtkNP_476745.1 PH_Btk 44..222 CDD:269944
SH3_Tec_like 346..399 CDD:212702
SH2_Tec_family 403..505 CDD:198188
PTKc_Tec_like 521..778 CDD:173637 92/276 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.