DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and Pvr

DIOPT Version :10

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster


Alignment Length:678 Identity:180/678 - (26%)
Similarity:268/678 - (39%) Gaps:246/678 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 LLFVLLL-LCLLIAQR--KMLQRRLGKQSMTTSSKQALPESGGGDF------------------A 747
            :||::|: ||:.:|.|  |..:|.|           ||..:|..:|                  .
  Fly   867 ILFLILIGLCVFLAVRYQKEHKRHL-----------ALKAAGLANFEEGAVGHINPDLTLDEQAE 920

  Fly   748 LMPLQSGFRFESGDAKWEFPREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKKGSN 812
            |:|....|         |||||.|:|...||.|.||.||||.|..|......|||||||:|..::
  Fly   921 LLPYNREF---------EFPRENLKLGKQLGAGAFGVVLKGEAKGIRREEPTTTVAVKMVKATAD 976

  Fly   813 SVEYMALLSEFQLLQEV-SHPNVIKLLGACTSSEAP---LLIIEYARYGSLRSYLRLSRK----- 868
            :....||:||.:::..: .|.||:.||||.|.:.|.   ::|:||.|:|:::::|..:||     
  Fly   977 NEVVRALVSELKIMVHLGQHLNVVNLLGAVTKNIAKRELMVIVEYCRFGNIQNFLLRNRKCFINQ 1041

  Fly   869 -------------------------------IECAGVDF-------------------------- 876
                                           ::.|.|.|                          
  Fly  1042 INPDTDHIDPSIMTQRMSDNYELHRDTNGGGLKYANVGFPIHSYINEPHNNNTQPPTHRRNSDND 1106

  Fly   877 ------------------------------------------------------ADGVEPVNVKM 887
                                                                  .|..|.:.|..
  Fly  1107 PRSGTRAGRTGSGTATYSYDRQMDTCATVMTTVPEDDQIMSNNSVQPAWRSNYKTDSTEAMTVTT 1171

  Fly   888 V--LTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYLKRSRDRV 950
            |  :::|:|:.:||.|||..|::|.||||||:||.:..:.||.||||.|.:|..|.|.|....::
  Fly  1172 VDLISWAFQVARGMDYLSSKKVLHGDLAARNILLCEDNVVKICDFGLARSMYRGDNYKKSENGKL 1236

  Fly   951 PVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGIAP-QNLWSLLKTGYRMDRPENCS 1014
            |:||:|.|||:|||:::.|||||:|::.||:.:|...|||||.| |.|::.|..||||::|:..:
  Fly  1237 PIKWLALESLSDHVFSTYSDVWSYGIVLWEMFSLAKVPYPGIDPNQELFNKLNDGYRMEKPKFAN 1301

  Fly  1015 EAVYSIVRTCWADEPNGRPSFKFLASEFEKLLGNN--AKYIDLETNAV-SNPLYCGDDSALITTE 1076
            :.:|.|:..||...|..||.|..|...|..:||.:  :.|:||....: ||..|....|......
  Fly  1302 QELYEIMLECWRKNPESRPLFAELEKRFANMLGEDVASHYLDLNNPYMQSNIEYMKKQSTDYLAL 1366

  Fly  1077 LGEPESLQHLWSPPKIAYDIHDQATSYDQSEEEMPVTSTAPPGYDLPRPLLDATANGQVLRYEND 1141
            :|.|:.|                              :.|.|.|          .||.::.    
  Fly  1367 MGSPDEL------------------------------APAAPRY----------VNGHIVP---- 1387

  Fly  1142 LRFPLNIRKSSCTPSYSNMT--SEPPATTSLPHYSVPVKRGRSYLDMTNKSLIPDNLDSREFEKH 1204
                 :||.......|..|:  |:|.|.|::  :|.....|.|       |..||          
  Fly  1388 -----DIRIEELPDDYMEMSRDSDPDACTAI--FSPTRLEGES-------SDFPD---------- 1428

  Fly  1205 LSKTISFRF---------SSLLNLSETK 1223
            .|...:|.|         |:.||...:|
  Fly  1429 FSSETTFNFPGARQSPTLSNNLNSGSSK 1456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 Protein Kinases, catalytic domain 770..1049 CDD:473864 122/401 (30%)
PvrNP_001162911.1 IG_like 346..432 CDD:214653
Ig strand C 363..366 CDD:409353
Ig strand E 396..400 CDD:409353
Ig strand F 410..415 CDD:409353
Ig strand G 425..428 CDD:409353
Ig 458..533 CDD:472250
Ig strand B 459..463 CDD:409353
Ig strand C 472..476 CDD:409353
Ig strand E 497..503 CDD:409353
Ig strand F 513..518 CDD:409353
Ig 671..>742 CDD:472250
Ig strand B 674..678 CDD:409353
Ig strand C 687..691 CDD:409353
Ig strand E 717..721 CDD:409353
Ig strand F 731..736 CDD:409353
Ig 779..851 CDD:472250
Ig strand B 781..785 CDD:409570
Ig strand C 794..798 CDD:409570
Ig strand E 816..821 CDD:409570
Ig strand F 831..836 CDD:409570
Ig strand G 844..847 CDD:409570
Protein Kinases, catalytic domain 927..1332 CDD:473864 126/413 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.