DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ret and FLT3

DIOPT Version :10

Sequence 1:NP_477044.1 Gene:Ret / 43875 FlyBaseID:FBgn0011829 Length:1235 Species:Drosophila melanogaster
Sequence 2:NP_004110.2 Gene:FLT3 / 2322 HGNCID:3765 Length:993 Species:Homo sapiens


Alignment Length:423 Identity:157/423 - (37%)
Similarity:215/423 - (50%) Gaps:74/423 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 VLNVAG---FECDRSCMFFVITCPLLFVLLLLCLLIAQRKMLQRRLGKQSMTTSSKQALPESGGG 744
            :||..|   |..|....:..|...|||:::|..|:..:.|       ||....|..|.:..:|..
Human   528 LLNSPGPFPFIQDNISFYATIGVCLLFIVVLTLLICHKYK-------KQFRYESQLQMVQVTGSS 585

  Fly   745 DFALMPLQSGFRFESGDAKWEFPREKLQLDTVLGEGEFGQVLKGFATEIAGLPGITTVAVKMLKK 809
            |.....:.  ||....|.|||||||.|:...|||.|.||:|:...|..|:.......|||||||:
Human   586 DNEYFYVD--FREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKE 648

  Fly   810 GSNSVEYMALLSEFQLLQEV-SHPNVIKLLGACTSSEAPLLIIEYARYGSLRSYLRLSR------ 867
            .::|.|..||:||.:::.:: ||.|::.||||||.|....||.||..||.|.:|||..|      
Human   649 KADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRT 713

  Fly   868 ---------------------------------------------------KIECAGVDFADGVE 881
                                                               :||.......:..|
Human   714 WTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEE 778

  Fly   882 PVNV---KMVLTFAWQICKGMAYLSELKLVHRDLAARNVLLADGKICKISDFGLTRDVYEDDAYL 943
            .:||   :.:|.||:|:.|||.:|.....|||||||||||:..||:.||.||||.||:..|..|:
Human   779 DLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYV 843

  Fly   944 KRSRDRVPVKWMAPESLADHVYTSKSDVWSFGVLCWELITLGASPYPGI-APQNLWSLLKTGYRM 1007
            .|...|:||||||||||.:.:||.||||||:|:|.||:.:||.:||||| ...|.:.|::.|::|
Human   844 VRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIQNGFKM 908

  Fly  1008 DRPENCSEAVYSIVRTCWADEPNGRPSFKFLAS 1040
            |:|...:|.:|.|:::|||.:...||||..|.|
Human   909 DQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTS 941

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RetNP_477044.1 Protein Kinases, catalytic domain 770..1049 CDD:473864 129/333 (39%)
FLT3NP_004110.2 ig 256..345 CDD:395002
Ig strand B 268..272 CDD:409448
Ig strand C 282..286 CDD:409448
Ig strand E 314..317 CDD:409448
Ig strand F 327..332 CDD:409448
Ig strand G 340..343 CDD:409448
Protein Kinases, catalytic domain 572..947 CDD:473864 143/372 (38%)
Important for normal regulation of the kinase activity and for maintaining the kinase in an inactive state in the absence of bound ligand 591..597 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.