DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and LEJ1

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_567952.1 Gene:LEJ1 / 829558 AraportID:AT4G34120 Length:238 Species:Arabidopsis thaliana


Alignment Length:209 Identity:42/209 - (20%)
Similarity:81/209 - (38%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PLTKSLTLRAPLVSSPMDTVTESEMAIAMALCGGIGIIHHNCTPEYQALEVHKVKKYKHGFMRDP 140
            |::.|.....||.:....:.....:.::........:.::|..|.       |...|..|....|
plant    28 PISSSSFSLLPLSNRRRSSTFSPSITVSAFFAAPASVNNNNSVPA-------KNGGYTVGDFMTP 85

  Fly   141 ----SVMSPTNTVGDVLEARRKNGFTGYPVTENGKLGGKLLGMVTSRDI---------------- 185
                .|:.|:.:|.|.||...:...||.||.::   ...|:|:|:..|:                
plant    86 RQNLHVVKPSTSVDDALELLVEKKVTGLPVIDD---NWTLVGVVSDYDLLALDSISGRSQNDTNL 147

  Fly   186 ---------DFRENQPEV------LLADIMTTELVTAPNGINLPTANAILEKSKKGKLPIVNQAG 235
                     .|.|.|..:      ::.|:||...:...:..||..|..:|.::|..:||:|:..|
plant   148 FPDVDSTWKTFNELQKLISKTYGKVVGDLMTPSPLVVRDSTNLEDAARLLLETKFRRLPVVDADG 212

  Fly   236 ELVAMIARTDLKKA 249
            :|:.::.|.::.:|
plant   213 KLIGILTRGNVVRA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 42/209 (20%)
LEJ1NP_567952.1 CBS_pair_plant_CBSX 85..226 CDD:341425 32/143 (22%)
CBS repeat 86..177 CDD:341425 18/93 (19%)
CBS repeat 182..225 CDD:341425 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.