DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and prkag3b

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001035456.2 Gene:prkag3b / 678619 ZFINID:ZDB-GENE-060421-6938 Length:342 Species:Danio rerio


Alignment Length:284 Identity:56/284 - (19%)
Similarity:105/284 - (36%) Gaps:96/284 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 IGIIH-HNCTPEYQ--ALEVHKVKKYKHGFMRDPSVMS-----PTNTVGDVLEARRKNGFTGYPV 166
            |.|:| :..:|..|  .||.||::.::..::: .||.|     |.:::.:.:.:..||.....||
Zfish   100 INILHRYYKSPLVQIYELEEHKIETWRETYLQ-YSVTSLISIAPDSSLFEAIYSLLKNKIHRLPV 163

  Fly   167 TENGKLGGKLLGMVTSRDI--------------DFRENQPEVL-------LADIMTTELVTAPNG 210
            .:...  |.:|.::|.:.|              .|.:.:.|.:       :|.:..||.|.    
Zfish   164 IDPET--GNVLHILTHKRILKFLHIFGSMIPKPRFLQKRIEEVEIGTFKSIATVKETETVY---- 222

  Fly   211 INLPTANAILEKSKKGKLPIVNQAGELVAMIARTD---LKKARSYPNASKDSNKQLLVGAAIGTR 272
                .|..|..:.:...||:||:.|::||:.:|.|   |...::|                    
Zfish   223 ----DALTIFVERRVSALPVVNEQGKVVALYSRFDVINLAAQKTY-------------------- 263

  Fly   273 SEDKARLALLVANGVDVIILDSSQGN--------SVYQVEMIKYIKETYPELQV-----IGGNVV 324
                        |.:::.:.::.||.        ..|..|.::.:.:...|.:|     :....|
Zfish   264 ------------NHLNMTMAEAIQGRWCCIEGVLKCYPHETLETVIDRIAEAEVHRLVLVDTEDV 316

  Fly   325 TRA--------QAKNLIDAGVDGL 340
            .|.        ||..|..|||:.|
Zfish   317 VRGIVSLSDLLQALVLTPAGVEAL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 56/284 (20%)
prkag3bNP_001035456.2 CBS_pair_5 54..183 CDD:239990 21/85 (25%)
CBS 135..255 CDD:223591 27/129 (21%)
CBS_pair_28 210..329 CDD:240012 26/158 (16%)
CBS 210..327 CDD:223591 26/156 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.