DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and gmpr2

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001035394.1 Gene:gmpr2 / 678545 ZFINID:ZDB-GENE-030131-1238 Length:348 Species:Danio rerio


Alignment Length:465 Identity:111/465 - (23%)
Similarity:176/465 - (37%) Gaps:151/465 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QNGEGLTYNDFLILPGYIDF-TAEEVDLSSPLTKSLTLR--------APLVSSPMDTVTESEMAI 102
            :|...|.:.|.|:.|..... :..|||    |.:|.|.|        .|:|::.||||...|||:
Zfish     5 ENDIKLDFKDVLLRPKRSTLKSRSEVD----LMRSFTFRNSKGSYRGIPIVAANMDTVGTFEMAL 65

  Fly   103 AMALCGGIGIIHHNCTPEYQALEVHKVKKYKHGFMRDPSVMSPTNTVGDVLEARRKNGFTGYPVT 167
            |:                             |.|              .:..|.:|:    |.| 
Zfish    66 AL-----------------------------HQF--------------SLFTAMQKH----YGV- 82

  Fly   168 ENGKLGGKLLGMVTSRDIDFRENQPEVLLADIMTTELVTAPNGINLPTANAILEKSKKGKLPIVN 232
            ::.|              :|....||.|       |.|....|    |:....||          
Zfish    83 DDWK--------------EFAAKHPECL-------ESVAVSTG----TSEGDFEK---------- 112

  Fly   233 QAGELVAMIARTDLKKARSYPNASKDSNKQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQG 297
             .|.:||.:.:                                           :..|.:|.:.|
Zfish   113 -LGAIVAAVPQ-------------------------------------------IRYICVDVANG 133

  Fly   298 NSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQ 362
            .|.:.|..:|.:::.:|...::.|||||....:.||.||.|.::||:|.||:|.|::....|.||
Zfish   134 YSEHFVNFVKDVRQKFPTHTIMAGNVVTGEMVEELILAGADIIKVGIGPGSVCTTRKKTGVGYPQ 198

  Fly   363 ATAVYQVSTYARQFGVPVIADGGIQSIGHIVKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVRL 427
            .:||.:.:..|...|..:|:|||....|.:.||...||..||:|.:|||..|:.||....:|.:.
Zfish   199 LSAVIECADAAHGLGGHIISDGGCTCPGDVSKAFGAGADFVMLGGMLAGHCESGGEVIEKNGKKY 263

  Fly   428 KKYRGMGSLEAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSCQ 492
            |.:.||.|..||:: .|.|.|          :.:.::|.:..:..||.|...|..:..|::.:|.
Zfish   264 KLFYGMSSDTAMKK-HAGGVA----------EYRASEGKTVEVPYKGPVDVTLRDVLGGVRSTCT 317

  Fly   493 DIGANSINKL 502
            .:||..:.:|
Zfish   318 YVGAAKLKEL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 111/465 (24%)
gmpr2NP_001035394.1 PRK05096 3..346 CDD:235343 111/465 (24%)
IMPDH 10..336 CDD:238223 110/460 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D618077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.