DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and Gmpr

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_030103212.1 Gene:Gmpr / 66355 MGIID:1913605 Length:393 Species:Mus musculus


Alignment Length:479 Identity:116/479 - (24%)
Similarity:183/479 - (38%) Gaps:117/479 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DAELQDGLSCKELFQNGEGLTYNDFLILPGYIDF-TAEEVDLSSPLT----KSLTLRAPLVSSPM 92
            ||:|:              |.:.|.|:.|..... :..||||....|    |......|::.:.|
Mouse     5 DADLK--------------LDFKDVLLRPKRSSLKSRSEVDLERTFTFRNSKQTYSGIPIIVANM 55

  Fly    93 DTVTESEMAIAMALCGGIGIIHHNCTPEYQALEVHKVKKYKHGFMRDPSVMSPTNTVGDVLEARR 157
            |||...|||:.|:.......:|                  ||..:.|...               
Mouse    56 DTVGTFEMAVVMSQHAMFTAVH------------------KHYSLDDWKC--------------- 87

  Fly   158 KNGFTGYPVTENGKLGGKLLGMVTSRDIDFRENQPEVLLADIMTTELVTAPNGINLPTANAILEK 222
                                         |.|..||.|       :..|.|.....|   :|...
Mouse    88 -----------------------------FAETHPECL-------QHPTIPASQQHP---SITPP 113

  Fly   223 SKKGKL--PIVNQAGELVAMIARTDLKKARSYPNASKDSNKQLLVGAAIGTRSEDKARLA--LLV 283
            ......  |.:..|....::|           |.:|:..:|...|..:.|:...|..|::  |..
Mouse   114 QHPASFYHPSIILASHHPSII-----------PASSQHPSKGKHVAVSSGSGQNDLERMSRILEA 167

  Fly   284 ANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLIDAGVDGLRVGMGSGS 348
            ...|..|.||.:.|.|.:.||.:|.::..:||..::.|||||....:.||.:|.|.::||:|.||
Mouse   168 VPQVKFICLDVANGYSEHFVEFVKLVRSKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGS 232

  Fly   349 ICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHIVKAIALGASAVMMGSLLAGTS 413
            :|.|:.....|.||.:||.:.:..|......:|:|||....|.:.||...||..||:|.:.:|.:
Mouse   233 VCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHT 297

  Fly   414 EAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSIVDKGSVLR 478
            |..||....:|.:||.:.||.|..||:: .|.|.|          :.:.::|.:..:..||.|..
Mouse   298 ECAGEVIERNGQKLKLFYGMSSDTAMKK-HAGGVA----------EYRASEGKTVEVPYKGDVEN 351

  Fly   479 YLPYLECGLQHSCQDIGANSINKL 502
            .:..:..||:.:|..:||..:.:|
Mouse   352 TILDILGGLRSTCTYVGAAKLKEL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 113/474 (24%)
GmprXP_030103212.1 PRK05096 3..393 CDD:235343 116/479 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D618077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.