DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and clcn6

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_009302552.1 Gene:clcn6 / 568122 ZFINID:ZDB-GENE-030131-2056 Length:863 Species:Danio rerio


Alignment Length:250 Identity:41/250 - (16%)
Similarity:77/250 - (30%) Gaps:100/250 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 PTNTVGDVLEARRKNGFTGYP-VTENGKLGGKLLGMVTSRDIDFRENQPEVLLADIMTTELVTAP 208
            |...:..::...|...:..:| ||||                  |:|:.|.:..:|:.:      
Zfish   608 PHTRIQSLVSILRTTVYHAFPVVTEN------------------RDNEKEFMKGNILIS------ 648

  Fly   209 NGINLPTANAILEKSKKGKLPIVNQAGELVAMIARTDLKKARSYPNASKDSNKQLLVGAAIGTRS 273
            |.|            |..|..::.:|||     .|...:..:|||::.                 
Zfish   649 NNI------------KFKKTSVLTRAGE-----QRRRCQSMKSYPSSE----------------- 679

  Fly   274 EDKARLALLVANGVD--VIILDSSQGNSVYQVEMIKYIKETYPEL-----------------QVI 319
                     :.|..|  |::..:.:|..:.| :|::.....||.|                 .:.
Zfish   680 ---------LRNVCDEHVVVEPTEEGQDILQ-QMLERRHAPYPNLYPDQSPSEEWTMEERFRPLT 734

  Fly   320 GGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYAR 374
            ...::.|:|..||:..||            |..:...:...|:.:.......|.|
Zfish   735 FHGLILRSQLVNLLIRGV------------CYAENQSSASQPRLSHSEMTEDYPR 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 40/249 (16%)
clcn6XP_009302552.1 ClC_6_like 45..582 CDD:239657
Voltage_CLC 135..564 CDD:279048
CBS 595..>633 CDD:278968 5/24 (21%)
CBS_pair_EriC_assoc_euk_bac 688..847 CDD:239964 16/102 (16%)
CBS 797..>847 CDD:223591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.