DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and PRKAG1

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_005269076.1 Gene:PRKAG1 / 5571 HGNCID:9385 Length:368 Species:Homo sapiens


Alignment Length:278 Identity:57/278 - (20%)
Similarity:107/278 - (38%) Gaps:77/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 APLVSSP------MDTVTESEMAIAMALCGGIGIIHH---NCTPEYQALEVHKVKKYKHGFMRD- 139
            |||..|.      |.|:|:.           |.|:|.   :...:...||.||::.::..:::| 
Human   109 APLWDSKKQSFVGMLTITDF-----------INILHRYYKSALVQIYELEEHKIETWREVYLQDS 162

  Fly   140 --PSV-MSPTNTVGDVLEARRKNGFTGYPVTENGKLGGKLLGMVTSRDIDFRE------NQPEVL 195
              |.| :||..::.|.:.:..:|.....||.: .:.|..|..:...|.:.|.:      .:||.:
Human   163 FKPLVCISPNASLFDAVSSLIRNKIHRLPVID-PESGNTLYILTHKRILKFLKLFITEFPKPEFM 226

  Fly   196 LADIMTTELVTAPNGINLPT------ANAILEKSKKGKLPIVNQAGELVAMIARTD---LKKARS 251
            ...:...::.|..|...:.|      |..|..:.:...||:|::.|.:|.:.::.|   |...::
Human   227 SKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKT 291

  Fly   252 YPNASKDSNKQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNSVYQVEMIK-YIKETYPE 315
            |                                |.:||.:..:.|..|.|...::| |:.||   
Human   292 Y--------------------------------NNLDVSVTKALQHRSHYFEGVLKCYLHET--- 321

  Fly   316 LQVIGGNVVTRAQAKNLI 333
            |:.|...:| .|:...|:
Human   322 LETIINRLV-EAEVHRLV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 57/278 (21%)
PRKAG1XP_005269076.1 CBS_pair_5 92..212 CDD:239990 26/114 (23%)
CBS 93..210 CDD:223591 26/112 (23%)
CBS 164..284 CDD:223591 25/120 (21%)
CBS_pair_28 239..358 CDD:240012 27/136 (20%)
CBS 240..356 CDD:223591 27/135 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.