DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and gmpr

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001018448.1 Gene:gmpr / 553639 ZFINID:ZDB-GENE-050522-48 Length:345 Species:Danio rerio


Alignment Length:240 Identity:75/240 - (31%)
Similarity:125/240 - (52%) Gaps:13/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 VGAAIGTRSEDKARL-ALLVANG-VDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRA 327
            |.|:.|:.:.|..:| ::|.|.. :..|.||.:.|.|.:.||.:|.::|.:|:..::.|||||..
Zfish    99 VAASSGSGAADLEKLCSILEAIPLIQYICLDVANGYSEHFVEFVKRVRERFPKHTIMAGNVVTGE 163

  Fly   328 QAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHI 392
            ..:.||.:|.|.::||:|.||:|.|:.....|.||.:||.:.:..|......:|:|||....|.:
Zfish   164 MVEELILSGADIIKVGIGPGSVCTTRIKTGVGYPQLSAVIECADSAHGLKGHIISDGGCSCPGDV 228

  Fly   393 VKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRYYHNEM 457
            .||...||..||:|.:|||..:..||....||.:.|.:.||.|..||::           |...:
Zfish   229 AKAFGAGADFVMLGGMLAGHDQCAGEVIEKDGKKFKLFYGMSSDTAMKK-----------YVGGV 282

  Fly   458 DKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSCQDIGANSINKL 502
            .:.:.::|.:..:..||.|...:..:..||:.:|..:||..:.:|
Zfish   283 AEYRASEGRTVQVPYKGDVENTIRDILGGLRSTCTYVGAAKLKEL 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 75/240 (31%)
gmprNP_001018448.1 PRK05096 3..345 CDD:235343 75/240 (31%)
IMPDH 10..336 CDD:238223 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D618077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.