DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and GMPR2

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001269951.1 Gene:GMPR2 / 51292 HGNCID:4377 Length:427 Species:Homo sapiens


Alignment Length:320 Identity:87/320 - (27%)
Similarity:144/320 - (45%) Gaps:65/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 VGAAIGTRSEDKARL--ALLVANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRA 327
            :.|:.||.|.|..:|  .|.....|..|.||.:.|.|.:.||.:|.:::.:|:..::.|||||..
Human   117 LAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGE 181

  Fly   328 QAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHI 392
            ..:.||.:|.|.::||:|.||:|.|::....|.||.:||.:.:..|......:|:|||....|.:
Human   182 MVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDV 246

  Fly   393 VKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRY----- 452
            .||...||..||:|.:|||.||:.||....||.:.|.:.||.|..||:: .|.|.|..||     
Human   247 AKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKK-YAGGVAEYRYVWRPR 310

  Fly   453 -----------------YHNE------------MDK-----------------MKVAQGVSGSIV 471
                             |.::            ::|                 ::.::|.:..:.
Human   311 SLVIVWRQNSWLLRGGWYSSQRSMVNRGSMLGSVEKSLGLRNPEGEDNKVFPTLRASEGKTVEVP 375

  Fly   472 DKGSVLRYLPYLECGLQHSCQDIGANSINKLRDMIYNGQLRFMKRTHSAQLEGNVHGLFS 531
            .||.|...:..:..|::.:|..:||..:.:|           .:||...::...|:.:||
Human   376 FKGDVEHTIRDILGGIRSTCTYVGAAKLKEL-----------SRRTTFIRVTQQVNPIFS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 87/320 (27%)
GMPR2NP_001269951.1 PRK05096 21..424 CDD:235343 85/318 (27%)
IMPDH 28..415 CDD:238223 84/309 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D618077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.