DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and Gmpr2

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_006251987.1 Gene:Gmpr2 / 192357 RGDID:628875 Length:348 Species:Rattus norvegicus


Alignment Length:365 Identity:94/365 - (25%)
Similarity:171/365 - (46%) Gaps:47/365 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 IDFRENQPEVLLADIMTTELVTAPNGINLPTANAILEKSKK--GKLPIV----NQAG--ELVAMI 241
            :||:    :|||....:|  :.:.:.::| |.:.....||:  ..:||:    :..|  |:..::
  Rat    10 LDFK----DVLLRPKRST--LKSRSEVDL-TRSFSFRNSKQMYSGIPIIAANMDTVGTFEMAKVL 67

  Fly   242 ARTDLKKA----------RSYPNASKDSNKQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQ 296
            .:..|..|          :.:.|.:.|..:.|...:..|:...::....|.....|..|.||.:.
  Rat    68 CKFSLFTAIHKHYSIHQWQEFANQNPDCLEYLAASSGTGSADFEQLEQILEAIPQVKYICLDVAN 132

  Fly   297 GNSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCP 361
            |.|.:.||.:|.:::.:|:..::.|||||....:.||.:|.|.::||:|.||:|.|::....|.|
  Rat   133 GYSEHFVESVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYP 197

  Fly   362 QATAVYQVSTYARQFGVPVIADGGIQSIGHIVKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVR 426
            |.:||.:.:..|......:|:|||....|.:.||...||..||:|.:|||.||:.||....:|.:
  Rat   198 QLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERNGKK 262

  Fly   427 LKKYRGMGSLEAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSC 491
            .|.:.||.|..||::           |...:.:.:.::|....:..||.|...:..:..|::.:|
  Rat   263 YKLFYGMSSEMAMKK-----------YSGGVAEYRASEGKIVEVPFKGDVEHTIRDILGGIRSTC 316

  Fly   492 QDIGANSINKLRDMIYNGQLRFMKRTHSAQLEGNVHGLFS 531
            ..:||..:.:|           .:||...::...|:.:||
  Rat   317 TYVGAAKLKEL-----------SRRTTFIRVTQQVNPIFS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 94/365 (26%)
Gmpr2XP_006251987.1 PRK05096 3..345 CDD:235343 92/363 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D618077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.