DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and gmpr-1

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_504202.1 Gene:gmpr-1 / 178834 WormBaseID:WBGene00017984 Length:358 Species:Caenorhabditis elegans


Alignment Length:249 Identity:72/249 - (28%)
Similarity:125/249 - (50%) Gaps:11/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 NASKDSNKQLLVGAAIGTRSEDKARLALLVANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQV 318
            :||.|:...|.:.:.|......|....:.....:..|.||.:.|.|...||.|:.::|.||:..:
 Worm    91 SASPDTFNNLAISSGISDNDWTKLNTVITELPQLKYICLDVANGYSESFVEFIRRVREAYPKHTI 155

  Fly   319 IGGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFGVPVIAD 383
            :.|||||....:.||.:|.|.::||:|.||:|.|::....|.||.:||.:.:..|......|::|
 Worm   156 MAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRKKAGVGYPQLSAVLECADAAHGLNGHVMSD 220

  Fly   384 GGIQSIGHIVKAIALGASAVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAA 448
            ||..:.|.:.||...||..||:|.|.||..::.|:....:|.:.|.:.||.|..||::       
 Worm   221 GGCSNPGDVAKAFGAGADFVMIGGLFAGHDQSGGDLIEHNGKKFKLFYGMSSDTAMKK------- 278

  Fly   449 MSRYYHNEMDKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSCQDIGANSINKL 502
                :|..:.:.:.::|.:.:|..:|.|...:..:..|::.:|...||..:.:|
 Worm   279 ----HHGSVAEYRASEGKTVTIPYRGDVNGTVQDILGGIRSACTYTGAKHLKEL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 72/249 (29%)
gmpr-1NP_504202.1 GMP_reduct_1 3..345 CDD:130372 72/249 (29%)
IMPDH 10..337 CDD:238223 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D618077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.