DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ras and CLCN6

DIOPT Version :9

Sequence 1:NP_001356940.1 Gene:ras / 43873 FlyBaseID:FBgn0003204 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001277.2 Gene:CLCN6 / 1185 HGNCID:2024 Length:869 Species:Homo sapiens


Alignment Length:195 Identity:41/195 - (21%)
Similarity:66/195 - (33%) Gaps:70/195 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 IGGNVVTRAQAKNLIDAGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFG------ 377
            |||.:.:..:..:..:.|              :|.:|:.|.. .||..........|||      
Human   258 IGGTLFSLEEGSSFWNQG--------------LTWKVLFCSM-SATFTLNFFRSGIQFGSWGSFQ 307

  Fly   378 VPVIADGGIQSIG-----------HIVKAIALGASAVM--MGSLLAGTSEAPGEYFFSDGVRLKK 429
            :|     |:.:.|           |:..|:.||...||  :|.||..|       |.....||.|
Human   308 LP-----GLLNFGEFKCSDSDKKCHLWTAMDLGFFVVMGVIGGLLGAT-------FNCLNKRLAK 360

  Fly   430 Y------------RGMGSL------------EAMERGDAKGAAMSRYYHNEMDKMKVAQGVSGSI 470
            |            |.:.||            .:|..|:.:..:.|....|:..:::|.:.|:.||
Human   361 YRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGECRQMSSSSQIGNDSFQLQVTEDVNSSI 425

  Fly   471  470
            Human   426  425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rasNP_001356940.1 PTZ00314 38..533 CDD:240355 41/195 (21%)
CLCN6NP_001277.2 ClC_6_like 49..588 CDD:239657 41/195 (21%)
Selectivity filter part_1. /evidence=ECO:0000250 156..160
Selectivity filter part_2. /evidence=ECO:0000250 198..202
Selectivity filter part_3. /evidence=ECO:0000250 487..491
CBS_pair_voltage-gated_CLC_euk_bac 600..856 CDD:341367
CBS repeat 606..806 CDD:341367
CBS repeat 812..855 CDD:341367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.