DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and ADAMTS4

DIOPT Version :10

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:NP_001307265.1 Gene:ADAMTS4 / 9507 HGNCID:220 Length:846 Species:Homo sapiens


Alignment Length:199 Identity:79/199 - (39%)
Similarity:105/199 - (52%) Gaps:13/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WTPWSSPSDCSRTCGGGVSYQTRECLRRDDR-GEAVCSGGSRRYFSCNTQDCPEEES-DFRAQQC 122
            |.||....||||||||||.:.:|:|.|...| |...|.|...|:.||||:|||...: .||.:||
Human   523 WGPWGPWGDCSRTCGGGVQFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQC 587

  Fly   123 SRFDR-----QQFDGVFYEWVP-YTN-AP-NPCELNCMPKGERFYYRQREKVVDGTRCNDKDLDV 179
            :.::.     :.|.|.. :||| ||. || :.|:|.|..:...:||....:|||||.|:.....|
Human   588 AAYNHRTDLFKSFPGPM-DWVPRYTGVAPQDQCKLTCQAQALGYYYVLEPRVVDGTPCSPDSSSV 651

  Fly   180 CVNGECMPVGCDMMLGSDAKEDKCRKCGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGATNIRI 244
            ||.|.|:..|||.::||..|.|||..||||||.|.....:.........:...|.|..|..::| 
Human   652 CVQGRCIHAGCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRCGTAWGSQLALQRGHCSLR- 715

  Fly   245 EETV 248
             :||
Human   716 -DTV 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559 26/51 (51%)
ADAMTS_CR_3 116..213 CDD:437068 44/104 (42%)
ADAMTS_spacer1 222..329 CDD:461796 6/27 (22%)
TSP1_ADAMTS 347..396 CDD:465950
TSP1_ADAMTS 400..457 CDD:465950
TSP1_ADAMTS 465..520 CDD:465950
TSP1_ADAMTS 580..632 CDD:465950
TSP1_ADAMTS 643..693 CDD:465950
MSCRAMM_ClfA <1049..1262 CDD:468110
Kunitz_papilin_lacunin-like 1612..1663 CDD:438681
Kunitz_BPTI 1670..1721 CDD:425421
Kunitz-type 1730..1780 CDD:438633
Kunitz_BPTI 1789..1840 CDD:425421
Kunitz_papilin_mig6-like 1849..1899 CDD:438679
Kunitz_papilin_mig6-like 1922..1972 CDD:438679
Kunitz_papilin_mig6-like 2001..2051 CDD:438679
Kunitz-type 2071..2121 CDD:438633
Kunitz_BPTI 2127..2178 CDD:425421
Kunitz_BPTI 2193..2245 CDD:425421
Kunitz_BPTI 2252..2303 CDD:425421
Kunitz_BPTI 2317..2372 CDD:425421
WAP 2455..2497 CDD:459672
Ig 2530..2610 CDD:472250
Ig strand B 2539..2543 CDD:409353
Ig strand C 2552..2556 CDD:409353
Ig strand E 2576..2579 CDD:409353
Ig strand F 2589..2594 CDD:409353
Ig strand G 2603..2606 CDD:409353
IG_like 2627..2703 CDD:214653
Ig strand B 2636..2640 CDD:409353
Ig strand C 2649..2653 CDD:409353
Ig strand E 2670..2674 CDD:409353
Ig strand F 2684..2689 CDD:409353
Ig strand G 2697..2700 CDD:409353
I-set 2766..2845 CDD:400151
Ig strand B 2771..2775 CDD:409353
Ig strand C 2784..2788 CDD:409353
Ig strand F 2821..2826 CDD:409353
PLAC 2851..2883 CDD:462560
ADAMTS4NP_001307265.1 Pep_M12B_propep 60..181 CDD:460254
Cysteine switch. /evidence=ECO:0000250 192..199
ZnMc_ADAMTS_like 218..425 CDD:239801
ADAMTS_CR_2 439..507 CDD:465496
TSP1 531..575 CDD:214559 23/43 (53%)
ADAMTS_CR_3 578..685 CDD:437068 44/107 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.