DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and ADAMTS10

DIOPT Version :9

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:NP_112219.3 Gene:ADAMTS10 / 81794 HGNCID:13201 Length:1103 Species:Homo sapiens


Alignment Length:683 Identity:205/683 - (30%)
Similarity:292/683 - (42%) Gaps:156/683 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LPESSVTPGGEGNDPDEWTPWSSPSDCSRTCGGGVSYQTREC-LRRDDRGEAVCSGGSRRYFSCN 106
            :|..|...|.:|    .|.||:...|||||||||||..:|.| ..|...|...|.|..||:.|||
Human   537 VPFGSRPEGVDG----AWGPWTPWGDCSRTCGGGVSSSSRHCDSPRPTIGGKYCLGERRRHRSCN 597

  Fly   107 TQDCPEEESDFRAQQCSRFDRQQFDGVFYEWVPYT-NAPNPCELNCMPKGERFYYRQREKVVDGT 170
            |.|||....|||..|||.||...|.|.||:|..|. .....|.|.|:.:|..||..:...|||||
Human   598 TDDCPPGSQDFREVQCSEFDSIPFRGKFYKWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVDGT 662

  Fly   171 RCNDKDLDVCVNGECMPVGCDMMLGSDAKEDKCRKCGGDGSTCKTIRNTITTKDLAPGYNDLLLL 235
            .|....:|:||:|||..||||.:||||.:|||||.||||||.|:||....:......||.|::.:
Human   663 PCRPDTVDICVSGECKHVGCDRVLGSDLREDKCRVCGGDGSACETIEGVFSPASPGAGYEDVVWI 727

  Fly   236 PEGATNIRIEETVPSSNYLACRNHSGHYYLNGDWRIDFPRPMFFANSWWNYQRKPMGFAAPDQ-- 298
            |:|:.:|.|::...|.::||.:.......|.|......|..:..|.:.:..::      .|||  
Human   728 PKGSVHIFIQDLNLSLSHLALKGDQESLLLEGLPGTPQPHRLPLAGTTFQLRQ------GPDQVQ 786

  Fly   299 -LTCSGPISESLFIVMLVQEKNISLDYEYSIPESLSHSQQDTHTWTHHQFNACSASCGGGSQSRK 362
             |...|||:.||.:::|.:.:..:|.|.::.|  ::......::|.:..:..|||.|.||||.:.
Human   787 SLEALGPINASLIVMVLARTELPALRYRFNAP--IARDSLPPYSWHYAPWTKCSAQCAGGSQVQA 849

  Fly   363 VTCNNRITLAEVNPSLCDQKSK-PVEEQACGTEPCAPHWVEGEWSKCSKGCGSDGFQNRSITCER 426
            |.|.|::..:.|.|..|...|| |..::||.||||.|.||.|.||.||:.|.: |.::||:.|:|
Human   850 VECRNQLDSSAVAPHYCSAHSKLPKRQRACNTEPCPPDWVVGNWSLCSRSCDA-GVRSRSVVCQR 913

  Fly   427 ISSSGEHTVEEDAVCLKEVGNKPATKQECNRDVKNCPKYHLGPWTPCDKLCGDGKQTRKVTCFIE 491
            ..|:.|....:|:.|                                                  
Human   914 RVSAAEEKALDDSAC-------------------------------------------------- 928

  Fly   492 ENGHKRVLPEEDCVEEKPETEKSCLLTPCEGVDWIISQWSGCNACGQNTETRTAICGNKEGKVYP 556
                                                                            |
Human   929 ----------------------------------------------------------------P 929

  Fly   557 EEFCEPEVPTLSRPCKSPKCEAQWFSSEWSKCSAPCGKGVKSRIVICGEFDGKTVTPADDDSKCN 621
                :|..|.| ..|..|.|..:|.:.:||:|:..||.|::.|:|:|...|.:...|   .:.|:
Human   930 ----QPRPPVL-EACHGPTCPPEWAALDWSECTPSCGPGLRHRVVLCKSADHRATLP---PAHCS 986

  Fly   622 KETKPESEQDCEGEEKVCPGEWFTGPWGKCSKPCGGGERVREVLCLSN-GTKSVNCDEEKVEPLS 685
            ...||.:...| ...:..|..|..|.||:||..||.|:|.|.|.|.|: |..|..|.|....|.:
Human   987 PAAKPPATMRC-NLRRCPPARWVAGEWGECSAQCGVGQRQRSVRCTSHTGQASHECTEALRPPTT 1050

  Fly   686 EKCNSEACTEDEILPLTSTDKPIE-DDEEDCDE 717
            ::|.::.            |.|.. |..|:|.:
Human  1051 QQCEAKC------------DSPTPGDGPEECKD 1071

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559 27/51 (53%)
ADAM_spacer1 214..329 CDD:283607 28/117 (24%)
TSP1 468..521 CDD:214559 0/52 (0%)
TSP_1 645..693 CDD:278517 19/48 (40%)
Kunitz_BPTI 1611..1663 CDD:278443
Kunitz_BPTI 1670..1721 CDD:278443
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522
Ig 2521..2610 CDD:299845
IG_like 2530..2610 CDD:214653
IG_like 2627..2703 CDD:214653
Ig 2636..2701 CDD:143165
IG_like 2766..2841 CDD:214653
Ig 2768..2830 CDD:299845
PLAC 2851..2883 CDD:285849
ADAMTS10NP_112219.3 Pep_M12B_propep 73..179 CDD:279848
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..233
Reprolysin 239..457 CDD:279729
ZnMc_ADAMTS_like 239..454 CDD:239801
TSP1 550..602 CDD:214559 27/51 (53%)
Spacer 706..828 29/129 (22%)
ADAM_spacer1 706..818 CDD:283607 28/117 (24%)
TSP1 829..885 CDD:214559 23/55 (42%)
TSP1 952..1003 CDD:214559 15/54 (28%)
TSP1 1010..1054 CDD:214559 18/43 (42%)
PLAC 1069..1100 CDD:285849 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11597
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.