DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and Adamts1

DIOPT Version :9

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:NP_077376.2 Gene:Adamts1 / 79252 RGDID:621241 Length:967 Species:Rattus norvegicus


Alignment Length:518 Identity:163/518 - (31%)
Similarity:233/518 - (44%) Gaps:115/518 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YLPESSVTPGGEG---------NDPD----------EWTPWSSPSDCSRTCGGGVSYQTRECLRR 87
            :.|.:..|..|||         |..|          .|.||....||||||||||.|..|||   
  Rat   525 HFPWADGTSCGEGKWCVSGKCVNKTDMKHFATPVHGSWGPWGPWGDCSRTCGGGVQYTMREC--- 586

  Fly    88 DD----RGEAVCSGGSRRYFSCNTQDCPEEE-SDFRAQQC---SRFDRQQF-DGVFYEWVPYTNA 143
            |:    .|...|.|...||.|||.:|||:.. ..||.:||   :.|.:..| :....||.|....
  Rat   587 DNPVPKNGGKYCEGKRVRYRSCNIEDCPDNNGKTFREEQCEAHNEFSKASFGNEPTVEWTPKYAG 651

  Fly   144 PNP---CELNCMPKGERFYYRQREKVVDGTRCNDKDLDVCVNGECMPVGCDMMLGSDAKEDKCRK 205
            .:|   |:|.|..||..:::..:.||||||.|:.....|||.|:|:..|||.::.|..|.|||..
  Rat   652 VSPKDRCKLTCEAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGV 716

  Fly   206 CGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGATNIRIEETVP-----SSNYLACRNHSGHYYL 265
            |||:|||||.|..|:|:  ..|||:|::.:|.|||||.::...|     :.::||.|...|.|.|
  Rat   717 CGGNGSTCKKISGTVTS--TRPGYHDIVTIPAGATNIEVKHRNPRGSRNNGSFLAIRAADGTYIL 779

  Fly   266 NGDWRID-FPRPMFFANSWWNYQRKPMGFAAPDQLTCSGPISESLFIVMLVQEKNISLDYEYSIP 329
            ||::.:. ..:.:.:..:...|....   ||.:::....|:.|.|.|.:|:              
  Rat   780 NGNFTLSTLEQDLTYKGTVLRYSGSS---AALERIRSFSPLKEPLTIQVLM-------------- 827

  Fly   330 ESLSHSQQDTHTWTHHQFNACSASCGGGSQSRKVTCNNRITLAEVNPSLCDQKSKPVEEQACGTE 394
              :.|:.:....:|:                                 ...:|::|.     ...
  Rat   828 --VGHALRPKIKYTY---------------------------------FMKKKTEPF-----NAI 852

  Fly   395 PCAPHWVEGEWSKCSKGCGSDGFQNRSITCERISSSGEHTVEEDAVCLKEVGNKPATKQECNRDV 459
            |....||..||.:|||.||| |:|.|.:.|..|:.   |...|   |.|||  |||:.:.| .|:
  Rat   853 PTFSEWVIEEWGECSKTCGS-GWQRRVVECRDING---HPASE---CAKEV--KPASTRPC-ADL 907

  Fly   460 KNCPKYHLGPWTPCDKLCGDGKQTRKVTCFIEENGHKRVLPEEDCVE-EKPETE-KSCLLTPC 520
            . ||::.:|.|:||.|.||.|.:.|.:.|...:.|   ||..|.|.. :||:.. ..|:||.|
  Rat   908 P-CPRWQVGDWSPCSKTCGKGYKKRTLKCLSHDGG---VLSNESCDPLKKPKHYIDFCILTQC 966

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559 27/54 (50%)
ADAM_spacer1 214..329 CDD:283607 31/120 (26%)
TSP1 468..521 CDD:214559 21/55 (38%)
TSP_1 645..693 CDD:278517
Kunitz_BPTI 1611..1663 CDD:278443
Kunitz_BPTI 1670..1721 CDD:278443
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522
Ig 2521..2610 CDD:299845
IG_like 2530..2610 CDD:214653
IG_like 2627..2703 CDD:214653
Ig 2636..2701 CDD:143165
IG_like 2766..2841 CDD:214653
Ig 2768..2830 CDD:299845
PLAC 2851..2883 CDD:285849
Adamts1NP_077376.2 Pep_M12B_propep 67..168 CDD:279848
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..252
Cysteine switch. /evidence=ECO:0000250 203..210
Reprolysin 258..467 CDD:279729
ZnMc_ADAMTS_like 258..463 CDD:239801
ADAM_CR 468..548 CDD:301627 5/22 (23%)
ADAM_CR 529..698 CDD:301627 62/171 (36%)
TSP1 562..614 CDD:214559 27/54 (50%)
Spacer 725..857 36/190 (19%)
ADAM_spacer1 725..842 CDD:283607 33/170 (19%)
TSP1 856..910 CDD:214559 26/64 (41%)
TSP1 912..>953 CDD:214559 15/43 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.