DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and col6a4a

DIOPT Version :9

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:XP_017207020.1 Gene:col6a4a / 564005 ZFINID:ZDB-GENE-041111-303 Length:2568 Species:Danio rerio


Alignment Length:157 Identity:52/157 - (33%)
Similarity:77/157 - (49%) Gaps:27/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1588 DGVTKATDEKFGGCEN--VQEPPQKA---CGLPKETGT-CNNYSVKYYFDTSYGGCARFWYGGCD 1646
            |...:..|::..|..:  :|.|....   |....:.|| |.:|..::|::.:..||..||||||.
Zfish  2409 DTAPETEDQQSSGRGDSIIQSPADNTDSLCRQSSDRGTVCGDYMQRWYYNPAVRGCLPFWYGGCG 2473

  Fly  1647 GNDNRFESEAECKDTCQDYTGK-----------------HVCLLPKSAGPCTGFTKKWYFDVDRN 1694
            ||.|||.||.||..||    ||                 ..||:.:..|||:.:...||:|:.:|
Zfish  2474 GNGNRFSSERECLQTC----GKKNPEVIPQTQVETALFNDACLMKQDVGPCSNYVLSWYYDIQQN 2534

  Fly  1695 RCEEFQYGGCYGTNNRFDSLEQCQGTC 1721
            .|.:|.:|||.|..|||::..:|:..|
Zfish  2535 ECSQFWFGGCEGNKNRFETRAECEALC 2561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559
ADAM_spacer1 214..329 CDD:283607
TSP1 468..521 CDD:214559
TSP_1 645..693 CDD:278517
Kunitz_BPTI 1611..1663 CDD:278443 24/55 (44%)
Kunitz_BPTI 1670..1721 CDD:278443 19/50 (38%)
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522
Ig 2521..2610 CDD:299845
IG_like 2530..2610 CDD:214653
IG_like 2627..2703 CDD:214653
Ig 2636..2701 CDD:143165
IG_like 2766..2841 CDD:214653
Ig 2768..2830 CDD:299845
PLAC 2851..2883 CDD:285849
col6a4aXP_017207020.1 vWA_collagen 35..198 CDD:238749
VWA 230..>362 CDD:278519
VWA 416..588 CDD:278519
VWA 622..784 CDD:278519
VWA 807..975 CDD:278519
VWA 995..1164 CDD:278519
vWA_collagen 1184..1351 CDD:238749
VWA <1451..1548 CDD:214621
Collagen 1584..1676 CDD:189968
Collagen 1659..1739 CDD:189968
Collagen 1786..1840 CDD:189968
Collagen 1842..1912 CDD:189968
VWA 1943..2107 CDD:278519
VWA 2153..2325 CDD:278519
Kunitz_BPTI 2438..2490 CDD:278443 25/55 (45%)
Kunitz_BPTI 2510..2561 CDD:278443 19/50 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.