Sequence 1: | NP_788752.2 | Gene: | Ppn / 43872 | FlyBaseID: | FBgn0003137 | Length: | 2898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035185.1 | Gene: | tfpi2 / 560339 | ZFINID: | ZDB-GENE-060503-38 | Length: | 233 | Species: | Danio rerio |
Alignment Length: | 253 | Identity: | 75/253 - (29%) |
---|---|---|---|
Similarity: | 113/253 - (44%) | Gaps: | 51/253 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1668 KHVCLLPKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTCAASENLP-TCE 1731
Fly 1732 QPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKDRCALPKQT 1796
Fly 1797 GDCSEKLAKWHFSESEKRCVPFYYSGCGGNKNNFPTLESCEDHCPRQVAKDICEIPAEVGECANY 1861
Fly 1862 VTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDRKPEPTTTTPATRPQPSRQ 1919 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppn | NP_788752.2 | TSP1 | 60..111 | CDD:214559 | |
ADAM_spacer1 | 214..329 | CDD:283607 | |||
TSP1 | 468..521 | CDD:214559 | |||
TSP_1 | 645..693 | CDD:278517 | |||
Kunitz_BPTI | 1611..1663 | CDD:278443 | |||
Kunitz_BPTI | 1670..1721 | CDD:278443 | 20/50 (40%) | ||
Kunitz_BPTI | 1729..1781 | CDD:278443 | 20/51 (39%) | ||
Kunitz_BPTI | 1789..1840 | CDD:278443 | 18/50 (36%) | ||
Kunitz_BPTI | 1848..1899 | CDD:278443 | 4/50 (8%) | ||
KU | 1920..1973 | CDD:238057 | 75/253 (30%) | ||
Kunitz_BPTI | 2001..2051 | CDD:278443 | |||
KU | 2071..2121 | CDD:238057 | |||
Kunitz_BPTI | 2127..2178 | CDD:278443 | |||
KU | 2192..2245 | CDD:238057 | |||
KU | 2251..2304 | CDD:238057 | |||
KU | 2316..2372 | CDD:238057 | |||
WAP | 2457..2497 | CDD:278522 | |||
Ig | 2521..2610 | CDD:299845 | |||
IG_like | 2530..2610 | CDD:214653 | |||
IG_like | 2627..2703 | CDD:214653 | |||
Ig | 2636..2701 | CDD:143165 | |||
IG_like | 2766..2841 | CDD:214653 | |||
Ig | 2768..2830 | CDD:299845 | |||
PLAC | 2851..2883 | CDD:285849 | |||
tfpi2 | NP_001035185.1 | KU | 28..80 | CDD:197529 | 20/51 (39%) |
Kunitz_BPTI | 89..141 | CDD:278443 | 20/51 (39%) | ||
Kunitz_BPTI | 149..201 | CDD:278443 | 19/94 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 66 | 1.000 | Domainoid score | I9926 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4295 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |