DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and col28a1a

DIOPT Version :10

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:76 Identity:34/76 - (44%)
Similarity:40/76 - (52%) Gaps:16/76 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1603 NVQE--PPQK--------------ACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNR 1651
            :|||  ||.|              .||...:.|.|..|||.:|:|.....||:||||||.||.||
Zfish  1092 HVQESSPPPKTLQPPHPDNSLKHVGCGQGLDPGPCREYSVMWYYDPQANACAQFWYGGCQGNSNR 1156

  Fly  1652 FESEAECKDTC 1662
            ||:|..||.||
Zfish  1157 FETEDICKSTC 1167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559
ADAMTS_CR_3 116..213 CDD:437068
ADAMTS_spacer1 222..329 CDD:461796
TSP1_ADAMTS 347..396 CDD:465950
TSP1_ADAMTS 400..457 CDD:465950
TSP1_ADAMTS 465..520 CDD:465950
TSP1_ADAMTS 580..632 CDD:465950
TSP1_ADAMTS 643..693 CDD:465950
MSCRAMM_ClfA <1049..1262 CDD:468110
Kunitz_papilin_lacunin-like 1612..1663 CDD:438681 28/51 (55%)
Kunitz_BPTI 1670..1721 CDD:425421
Kunitz-type 1730..1780 CDD:438633
Kunitz_BPTI 1789..1840 CDD:425421
Kunitz_papilin_mig6-like 1849..1899 CDD:438679
Kunitz_papilin_mig6-like 1922..1972 CDD:438679
Kunitz_papilin_mig6-like 2001..2051 CDD:438679
Kunitz-type 2071..2121 CDD:438633
Kunitz_BPTI 2127..2178 CDD:425421
Kunitz_BPTI 2193..2245 CDD:425421
Kunitz_BPTI 2252..2303 CDD:425421
Kunitz_BPTI 2317..2372 CDD:425421
WAP 2455..2497 CDD:459672
Ig 2530..2610 CDD:472250
Ig strand B 2539..2543 CDD:409353
Ig strand C 2552..2556 CDD:409353
Ig strand E 2576..2579 CDD:409353
Ig strand F 2589..2594 CDD:409353
Ig strand G 2603..2606 CDD:409353
IG_like 2627..2703 CDD:214653
Ig strand B 2636..2640 CDD:409353
Ig strand C 2649..2653 CDD:409353
Ig strand E 2670..2674 CDD:409353
Ig strand F 2684..2689 CDD:409353
Ig strand G 2697..2700 CDD:409353
I-set 2766..2845 CDD:400151
Ig strand B 2771..2775 CDD:409353
Ig strand C 2784..2788 CDD:409353
Ig strand F 2821..2826 CDD:409353
PLAC 2851..2883 CDD:462560
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
gly_rich_SclB <246..>551 CDD:468478
gly_rich_SclB <482..>766 CDD:468478
VWA 802..980 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1117..1167 CDD:438671 26/49 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.