powered by:
Protein Alignment Ppn and col28a1a
DIOPT Version :9
Sequence 1: | NP_788752.2 |
Gene: | Ppn / 43872 |
FlyBaseID: | FBgn0003137 |
Length: | 2898 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001334976.1 |
Gene: | col28a1a / 555428 |
ZFINID: | ZDB-GENE-070705-84 |
Length: | 1170 |
Species: | Danio rerio |
Alignment Length: | 76 |
Identity: | 34/76 - (44%) |
Similarity: | 40/76 - (52%) |
Gaps: | 16/76 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1603 NVQE--PPQK--------------ACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNR 1651
:||| ||.| .||...:.|.|..|||.:|:|.....||:||||||.||.||
Zfish 1092 HVQESSPPPKTLQPPHPDNSLKHVGCGQGLDPGPCREYSVMWYYDPQANACAQFWYGGCQGNSNR 1156
Fly 1652 FESEAECKDTC 1662
||:|..||.||
Zfish 1157 FETEDICKSTC 1167
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
76 |
1.000 |
Domainoid score |
I8876 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3538 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.