DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and MAG

DIOPT Version :9

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:NP_002352.1 Gene:MAG / 4099 HGNCID:6783 Length:626 Species:Homo sapiens


Alignment Length:380 Identity:80/380 - (21%)
Similarity:129/380 - (33%) Gaps:138/380 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  2575 GDLTIVQVRQTDDGTYVCVA---------SNGLGEPVRREVALQVTEP-------------VSQP 2617
            |:..::...:.|:||:|.|:         :||      ..:..|.:.|             |..|
Human   181 GEPAVLGRLREDEGTWVQVSLLHFVPTREANG------HRLGCQASFPNTTLQFEGYASMDVKYP 239

  Fly  2618 AYIYGDKNVTQIVELNRPAVIRCPAGGFPEPHVSWWRNGQMFGLKNNLMARDYSLVFNSIQLSDL 2682
            ..|....:..:.:|.:..::: |.|...|.|.::|.|:|.:.   ...:|....|....:..::.
Human   240 PVIVEMNSSVEAIEGSHVSLL-CGADSNPPPLLTWMRDGTVL---REAVAESLLLELEEVTPAED 300

  Fly  2683 GLYTC---EVYNQ-RRPVSLRVTLKAVGPVRPLSPEEEQYMQYVLNPATRPVTQRPSYPYRPTRP 2743
            |:|.|   ..|.| .|.|.|.|                                           
Human   301 GVYACLAENAYGQDNRTVGLSV------------------------------------------- 322

  Fly  2744 AYVP-EPTVNVHAVLALEPKNSYTPGSTIVMSCSVQGYPEPNVTWIKD----DVPLYNNERVQIT 2803
            .|.| :|||| ..::|:|       |.|:.:.||.|..|:|.:|..|:    ...:|.:|.    
Human   323 MYAPWKPTVN-GTMVAVE-------GETVSILCSTQSNPDPILTIFKEKQILSTVIYESEL---- 375

  Fly  2804 YQPHRLVLSDVTSADSGKYTCRASNAYTYANGEANVSIQ--SVVPVSPECVDNPYFANCKLIVKG 2866
                :|.|..|:..|.|:|.|.|.|.|.......|:|::  .|:.:...|........|..:|| 
Human   376 ----QLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPVLLLESHCAAARDTVQCLCVVK- 435

  Fly  2867 RYCSNP----------------------YYTQFCCRS-------CTLAGQVASPP 2892
               |||                      .|::   ||       .||.||..:||
Human   436 ---SNPEPSVAFELPSRNVTVNESEREFVYSE---RSGLVLTSILTLRGQAQAPP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559
ADAM_spacer1 214..329 CDD:283607
TSP1 468..521 CDD:214559
TSP_1 645..693 CDD:278517
Kunitz_BPTI 1611..1663 CDD:278443
Kunitz_BPTI 1670..1721 CDD:278443
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522
Ig 2521..2610 CDD:299845 8/43 (19%)
IG_like 2530..2610 CDD:214653 8/43 (19%)
IG_like 2627..2703 CDD:214653 19/79 (24%)
Ig 2636..2701 CDD:143165 17/68 (25%)
IG_like 2766..2841 CDD:214653 22/78 (28%)
Ig 2768..2830 CDD:299845 20/65 (31%)
PLAC 2851..2883 CDD:285849 10/60 (17%)
MAGNP_002352.1 Interaction with RTN4R and RTN4RL2. /evidence=ECO:0000250|UniProtKB:P07722 20..325 32/196 (16%)
Ig_Siglec_N 22..139 CDD:143189
Ganglioside GT1b binding. /evidence=ECO:0000250|UniProtKB:P20917 65..67
Ganglioside GT1b binding. /evidence=ECO:0000250|UniProtKB:P20917 124..128
Ig 141..223 CDD:325142 9/47 (19%)
Ig_3 239..309 CDD:316449 15/73 (21%)
IG_like 333..409 CDD:214653 24/90 (27%)
Required for normal axon myelination in the central nervous system. /evidence=ECO:0000250|UniProtKB:P20917 577..626
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.