Sequence 1: | NP_788752.2 | Gene: | Ppn / 43872 | FlyBaseID: | FBgn0003137 | Length: | 2898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001296732.1 | Gene: | tfpia / 359833 | ZFINID: | ZDB-GENE-030711-1 | Length: | 279 | Species: | Danio rerio |
Alignment Length: | 221 | Identity: | 74/221 - (33%) |
---|---|---|---|
Similarity: | 97/221 - (43%) | Gaps: | 48/221 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1671 CLLPKSAGPCTGFTKKWYFDVDRNRCEEFQYGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVE 1735
Fly 1736 SGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLK------------- 1787
Fly 1788 -------------------------------DRCALPKQTGDCSEKLAKWHFSESEKRCVPFYYS 1821
Fly 1822 GCGGNKNNFPTLESCEDHCPRQVAKD 1847 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppn | NP_788752.2 | TSP1 | 60..111 | CDD:214559 | |
ADAM_spacer1 | 214..329 | CDD:283607 | |||
TSP1 | 468..521 | CDD:214559 | |||
TSP_1 | 645..693 | CDD:278517 | |||
Kunitz_BPTI | 1611..1663 | CDD:278443 | |||
Kunitz_BPTI | 1670..1721 | CDD:278443 | 23/49 (47%) | ||
Kunitz_BPTI | 1729..1781 | CDD:278443 | 21/51 (41%) | ||
Kunitz_BPTI | 1789..1840 | CDD:278443 | 19/50 (38%) | ||
Kunitz_BPTI | 1848..1899 | CDD:278443 | 74/221 (33%) | ||
KU | 1920..1973 | CDD:238057 | |||
Kunitz_BPTI | 2001..2051 | CDD:278443 | |||
KU | 2071..2121 | CDD:238057 | |||
Kunitz_BPTI | 2127..2178 | CDD:278443 | |||
KU | 2192..2245 | CDD:238057 | |||
KU | 2251..2304 | CDD:238057 | |||
KU | 2316..2372 | CDD:238057 | |||
WAP | 2457..2497 | CDD:278522 | |||
Ig | 2521..2610 | CDD:299845 | |||
IG_like | 2530..2610 | CDD:214653 | |||
IG_like | 2627..2703 | CDD:214653 | |||
Ig | 2636..2701 | CDD:143165 | |||
IG_like | 2766..2841 | CDD:214653 | |||
Ig | 2768..2830 | CDD:299845 | |||
PLAC | 2851..2883 | CDD:285849 | |||
tfpia | NP_001296732.1 | Kunitz_BPTI | 42..92 | CDD:278443 | 23/49 (47%) |
KU | 99..151 | CDD:238057 | 21/51 (41%) | ||
Kunitz_BPTI | 205..256 | CDD:278443 | 21/54 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 66 | 1.000 | Domainoid score | I9926 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4295 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |