DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and ADAMTSL5

DIOPT Version :9

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:XP_011526263.1 Gene:ADAMTSL5 / 339366 HGNCID:27912 Length:485 Species:Homo sapiens


Alignment Length:436 Identity:140/436 - (32%)
Similarity:191/436 - (43%) Gaps:55/436 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GGEGNDPDEWTPWSSPSDCSRTCGGGVSYQTRECLRRDDRGEAVCSGGSRRYFSCNTQDCPEEES 115
            |.....|.|||||.|.:.||.:||.|||.::|.|||..  ||..|.|.|..|..|...|||....
Human    39 GVSAQGPGEWTPWVSWTRCSSSCGRGVSVRSRRCLRLP--GEEPCWGDSHEYRLCQLPDCPPGAV 101

  Fly   116 DFRAQQCSRFDRQQFDGV--FYEWVPYTNAPNPCELNCMPKGERFYYRQREKVVDGTRCNDKDLD 178
            .||..||:.::.:...|.  .|:|||:..|||.|:|||:.:|..||: ...:|:|||.|:.....
Human   102 PFRDLQCALYNGRPVLGTQKTYQWVPFHGAPNQCDLNCLAEGHAFYH-SFGRVLDGTACSPGAQG 165

  Fly   179 VCVNGECMPVGCDMMLGSDAKEDKCRKCGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGATNIR 243
            |||.|.|:..|||.:|||.|.||:|.:|||...:|..::..........||.::.|:||||.:||
Human   166 VCVAGRCLSAGCDGLLGSGALEDRCGRCGGANDSCLFVQRVFRDAGAFAGYWNVTLIPEGARHIR 230

  Fly   244 IEETVPSSNYL----ACRNHSGHYYLNGDWRIDFPRPMFFANSWWNYQRKPMGFAAPDQ-LTCSG 303
            :|..  |.|:|    :.....|.|.|||.|.:..|.....|.:...|.|.    ..|.: |..:|
Human   231 VEHR--SRNHLGILGSLMGGDGRYVLNGHWVVSPPGTYEAAGTHVVYTRD----TGPQETLQAAG 289

  Fly   304 PISESLFIVMLVQEKNISLDYEYSIP-ESLSHSQQDTHT--WTHHQFNACSASCGGGSQSRKVTC 365
            |.|..|.:.:|:||.|..:::|:.:| |..|..|.....  |...|           .|.|.|  
Human   290 PTSHDLLLQVLLQEPNPGIEFEFWLPRERYSPFQARVQALGWPLRQ-----------PQPRGV-- 341

  Fly   366 NNRITLAEVNPSLCDQKSKPVEEQACGTEPCAP-HWVEGEWSKCSKGCGSD-GFQNRSITCERIS 428
                   |..|......: |.:......:||.| ....|...:....|||| .||.|.:      
Human   342 -------EPQPPAAPAVT-PAQTPTLAPDPCPPCPDTRGRAHRLLHYCGSDFVFQARVL------ 392

  Fly   429 SSGEH-----TVEEDAVCLKEVGNKPATKQECNRDVKNCPKYHLGP 469
              |.|     |..|..:.|......|...:|......:||...|.|
Human   393 --GHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559 24/50 (48%)
ADAM_spacer1 214..329 CDD:283607 34/119 (29%)
TSP1 468..521 CDD:214559 1/2 (50%)
TSP_1 645..693 CDD:278517
Kunitz_BPTI 1611..1663 CDD:278443
Kunitz_BPTI 1670..1721 CDD:278443
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522
Ig 2521..2610 CDD:299845
IG_like 2530..2610 CDD:214653
IG_like 2627..2703 CDD:214653
Ig 2636..2701 CDD:143165
IG_like 2766..2841 CDD:214653
Ig 2768..2830 CDD:299845
PLAC 2851..2883 CDD:285849
ADAMTSL5XP_011526263.1 TSP1 48..97 CDD:214559 24/50 (48%)
ADAM_CR <106..174 CDD:301627 27/68 (40%)
ADAM_spacer1 206..315 CDD:283607 34/114 (30%)
NTR_like 379..480 CDD:239600 18/66 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.