powered by:
Protein Alignment Ppn and Acp24A4
DIOPT Version :9
Sequence 1: | NP_788752.2 |
Gene: | Ppn / 43872 |
FlyBaseID: | FBgn0003137 |
Length: | 2898 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001036330.1 |
Gene: | Acp24A4 / 318936 |
FlyBaseID: | FBgn0051779 |
Length: | 78 |
Species: | Drosophila melanogaster |
Alignment Length: | 54 |
Identity: | 24/54 - (44%) |
Similarity: | 31/54 - (57%) |
Gaps: | 1/54 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1847 DICEIPAEV-GECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARC 1899
:||.:||.. |.|....:.|.||.|...|..|.||||.||||.|.::|.|:.:|
Fly 23 EICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEECINKC 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.