powered by:
Protein Alignment Ppn and CG31609
DIOPT Version :9
Sequence 1: | NP_788752.2 |
Gene: | Ppn / 43872 |
FlyBaseID: | FBgn0003137 |
Length: | 2898 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_723444.2 |
Gene: | CG31609 / 318845 |
FlyBaseID: | FBgn0051609 |
Length: | 123 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 30/64 - (46%) |
Similarity: | 36/64 - (56%) |
Gaps: | 7/64 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1990 RQPDPAPTVAQCSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARCSV 2053
:|| :|...|:||.||.:...|.|:....||..|||||||||.|||.|:|||...|.|
Fly 27 KQP-------KCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCRV 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
60 |
1.000 |
Domainoid score |
I10576 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3538 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.