DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and Adamts8

DIOPT Version :9

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:NP_038934.2 Gene:Adamts8 / 30806 MGIID:1353468 Length:905 Species:Mus musculus


Alignment Length:376 Identity:115/376 - (30%)
Similarity:177/376 - (47%) Gaps:54/376 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EWTPWSSPSDCSRTCGGGVSYQTRECLRRDD----RGEAVCSGGSRRYFSCNTQDCPEEESDFRA 119
            :|.||.....||||||||:.:..|||   |:    .|...|.|...:|.||||::||.....||.
Mouse   544 DWGPWRPWGQCSRTCGGGIQFSNREC---DNPMPQNGGRFCLGERVKYQSCNTEECPPNGKSFRE 605

  Fly   120 QQCSR---FDRQQFDGVFYEWVPYTNAPNP---CELNCMPKGERFYYRQREKVVDGTRCNDKDLD 178
            |||.:   ::....||.|.:|||..:..:|   |:|.|..:|...:.....||:|||.|....|.
Mouse   606 QQCEKYNAYNHTDLDGNFLQWVPKYSGVSPRDRCKLFCRARGRSEFKVFEAKVIDGTLCGPDTLS 670

  Fly   179 VCVNGECMPVGCDMMLGSDAKEDKCRKCGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGATNIR 243
            :||.|:|:..|||.::.|..|.|||..|||.|:.|:.|..:.|  ..:.||||::.:|.|||||.
Mouse   671 ICVRGQCVKAGCDHVVNSPKKLDKCGVCGGKGTACRKISGSFT--PFSYGYNDIVTIPAGATNID 733

  Fly   244 IEE-TVP----SSNYLACRNHSGHYYLNGDWRID-FPRPMFFANSWWNYQRKPMGFAAPDQLTCS 302
            ::: :.|    ..:|||.:..:|.|.|||:..|. ..:.:....:...|..   ..|..::|...
Mouse   734 VKQRSHPGVRNDGSYLALKTANGQYLLNGNLAISAIEQDILVKGTILKYSG---SMATLERLQSF 795

  Fly   303 GPISESLFIVMLVQEKNI---SLDYEYSIPESLSHSQQDTH--------------TWTHHQFNAC 350
            ..:.|.|.:.:|.....:   .:.|.:.:|..:..|.|::.              .|....::.|
Mouse   796 QALPEPLTVQLLTVSGEVFPPKVRYTFFVPNDMDFSVQNSKERATTNIIQSLPSAEWVLGDWSEC 860

  Fly   351 SASCGGGSQSRKVTCNNRITLAEVNPS-----LCDQKSKPVEEQACGTEPC 396
            .::|.|..|.|.|.|.        :||     .||:..||.:.:.||::||
Mouse   861 PSTCRGSWQRRTVECR--------DPSGQASDTCDEALKPEDAKPCGSQPC 903

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559 23/54 (43%)
ADAM_spacer1 214..329 CDD:283607 29/123 (24%)
TSP1 468..521 CDD:214559
TSP_1 645..693 CDD:278517
Kunitz_BPTI 1611..1663 CDD:278443
Kunitz_BPTI 1670..1721 CDD:278443
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522
Ig 2521..2610 CDD:299845
IG_like 2530..2610 CDD:214653
IG_like 2627..2703 CDD:214653
Ig 2636..2701 CDD:143165
IG_like 2766..2841 CDD:214653
Ig 2768..2830 CDD:299845
PLAC 2851..2883 CDD:285849
Adamts8NP_038934.2 Pep_M12B_propep 52..152 CDD:279848
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..163
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..225
Reprolysin 234..444 CDD:279729
ZnMc_ADAMTS_like 234..441 CDD:239801
ADAM_CR 463..529 CDD:301627
TSP1 545..597 CDD:214559 23/54 (43%)
Spacer 706..847 32/145 (22%)
ADAM_spacer1 706..825 CDD:283607 29/123 (24%)
TSP1 852..904 CDD:214559 18/60 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 877..905 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11845
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.