DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and Adamts15

DIOPT Version :9

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:NP_001100280.1 Gene:Adamts15 / 300474 RGDID:1309770 Length:950 Species:Rattus norvegicus


Alignment Length:521 Identity:160/521 - (30%)
Similarity:225/521 - (43%) Gaps:96/521 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YLPESSVTPGGEG-----------NDPDE------WTPWSSPSDCSRTCGGGVSYQTRECLR-RD 88
            :.|.:..|..|||           ::|::      |..|.....|||||||||....|:|.. ..
  Rat   484 HFPWADGTSCGEGKFCLKGACVERHNPNKYRVDGSWAKWEPYGPCSRTCGGGVQLARRQCSNPTP 548

  Fly    89 DRGEAVCSGGSRRYFSCNTQDCPEEES--DFRAQQCSRFDRQQFDGVFYE---------WVPYTN 142
            ..|...|.|...:|.|||.:.||...|  .||.:||     :.|:|..:.         |||..:
  Rat   549 ANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQC-----EAFNGYNHSTNRLTLAVAWVPKYS 608

  Fly   143 APNP---CELNCMPKGERFYYRQREKVVDGTRCNDKDLDVCVNGECMPVGCDMMLGSDAKEDKCR 204
            ..:|   |:|.|...|..::|....||||||.|......|||.|:|:..|||..|||..|.|||.
  Rat   609 GVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCTPDSTSVCVQGKCIKAGCDGNLGSKKKFDKCG 673

  Fly   205 KCGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGATNIRIEE-----TVPSSNYLACRNHSGHYY 264
            .||||..:||.:.. :.||.: .|||.::.:|.||::|.|.:     .:...||||.:|..|.|.
  Rat   674 VCGGDNKSCKRVTG-LFTKPM-HGYNFVVAIPAGASSIDIRQRGYKGLIGDDNYLALKNSQGKYL 736

  Fly   265 LNGDWRID-FPRPMFFANSWWNYQRKPMGFAAPDQLTCSGPISESLFIVMLVQEKNI--SLDYEY 326
            |||.:.:. ..|.:....|...|....   .|.:.|..|.||.|.|.:.:|...|..  .:.|.:
  Rat   737 LNGHFVVSAVERDLVVKGSVLRYSGTG---TAVESLQASRPILEPLTVEVLSVGKMTPPRVRYSF 798

  Fly   327 SIPESLSHSQQDTHTWTHHQFNACSASCGGGSQSRKVTCNNRITLAEVNPSLCDQKSKPVEEQAC 391
            .:|:   ..::|                   ..||.........|.....||.:|..:|      
  Rat   799 YLPK---EPRED-------------------KSSRPKDPRGPPVLRNSVLSLSNQVEQP------ 835

  Fly   392 GTEPCAPHWVEGEWSKCSKGCGSDGFQNRSITCERISSSGEHTVEEDAVCLKEVGNKPATKQECN 456
            ...|.| .||.|.|..||..||| |.|.|::.|.  .|.|:..:   :.|  :|.::|..|:.|.
  Rat   836 DNRPPA-RWVAGNWGPCSVSCGS-GLQKRAVDCR--DSPGQQGI---SAC--DVDHRPVEKRACG 891

  Fly   457 RDVKNCPKYHLGPWTPCDKLCGDGKQTRKVTCFIEENGH-KRVLPEEDC-VEEKPETEKSCLLTP 519
               :.||.:.||.|:||.|.||.|.:.|.:.|.    || .|:|..:.| :..||:....|:|.|
  Rat   892 ---EPCPTWELGNWSPCSKSCGRGFKRRPLKCV----GHGGRLLARDQCDLRRKPQELDFCVLRP 949

  Fly   520 C 520
            |
  Rat   950 C 950

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559 20/51 (39%)
ADAM_spacer1 214..329 CDD:283607 34/122 (28%)
TSP1 468..521 CDD:214559 21/55 (38%)
TSP_1 645..693 CDD:278517
Kunitz_BPTI 1611..1663 CDD:278443
Kunitz_BPTI 1670..1721 CDD:278443
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522
Ig 2521..2610 CDD:299845
IG_like 2530..2610 CDD:214653
IG_like 2627..2703 CDD:214653
Ig 2636..2701 CDD:143165
IG_like 2766..2841 CDD:214653
Ig 2768..2830 CDD:299845
PLAC 2851..2883 CDD:285849
Adamts15NP_001100280.1 Pep_M12B_propep 42..157 CDD:279848
Reprolysin 218..427 CDD:279729
ZnMc_ADAMTS_like 218..424 CDD:239801
ADAM_CR 437..506 CDD:301627 5/21 (24%)
TSP1 519..571 CDD:214559 20/51 (39%)
ADAM_spacer1 683..801 CDD:283607 34/122 (28%)
TSP1 846..895 CDD:214559 18/59 (31%)
TSP1 897..950 CDD:214559 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.