DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and AMBP

DIOPT Version :10

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:142 Identity:54/142 - (38%)
Similarity:67/142 - (47%) Gaps:15/142 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  2044 EEECSARCSVNIDIRIGADPVEHDTSK---CFLAFEPGNCYNNVTRWFYNSAEGLCDEFVYTGCG 2105
            |||.|.          |...|...|.|   |.|.:..|.|....:|:|||.....|:.|.|.||.
Human   211 EEEGSG----------GGQLVTEVTK
KEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCM 265

  Fly  2106 GNANNYATEEECQNECNDAQTTCALPPVRGRCSDLSRRWYFDERSGECHEFEFTGCRGNRNNFVS 2170
            ||.||:.||:||...|... ..|.||.|||.|....:.|.||...|:|..|.:.||:||.|.|.|
Human   266 GNGNNFVTEKECLQTCR
TV-AACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYS 329

  Fly  2171 QSDCLNFCIGEP 2182
            :.:|..:| |.|
Human   330 EKECREYC-GVP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559
ADAMTS_CR_3 116..213 CDD:437068
ADAMTS_spacer1 222..329 CDD:461796
TSP1_ADAMTS 347..396 CDD:465950
TSP1_ADAMTS 400..457 CDD:465950
TSP1_ADAMTS 465..520 CDD:465950
TSP1_ADAMTS 580..632 CDD:465950
TSP1_ADAMTS 643..693 CDD:465950
MSCRAMM_ClfA <1049..1262 CDD:468110
Kunitz_papilin_lacunin-like 1612..1663 CDD:438681
Kunitz_BPTI 1670..1721 CDD:425421
Kunitz-type 1730..1780 CDD:438633
Kunitz_BPTI 1789..1840 CDD:425421
Kunitz_papilin_mig6-like 1849..1899 CDD:438679
Kunitz_papilin_mig6-like 1922..1972 CDD:438679
Kunitz_papilin_mig6-like 2001..2051 CDD:438679 4/6 (67%)
Kunitz-type 2071..2121 CDD:438633 21/49 (43%)
Kunitz_BPTI 2127..2178 CDD:425421 21/50 (42%)
Kunitz_BPTI 2193..2245 CDD:425421
Kunitz_BPTI 2252..2303 CDD:425421
Kunitz_BPTI 2317..2372 CDD:425421
WAP 2455..2497 CDD:459672
Ig 2530..2610 CDD:472250
Ig strand B 2539..2543 CDD:409353
Ig strand C 2552..2556 CDD:409353
Ig strand E 2576..2579 CDD:409353
Ig strand F 2589..2594 CDD:409353
Ig strand G 2603..2606 CDD:409353
IG_like 2627..2703 CDD:214653
Ig strand B 2636..2640 CDD:409353
Ig strand C 2649..2653 CDD:409353
Ig strand E 2670..2674 CDD:409353
Ig strand F 2684..2689 CDD:409353
Ig strand G 2697..2700 CDD:409353
I-set 2766..2845 CDD:400151
Ig strand B 2771..2775 CDD:409353
Ig strand C 2784..2788 CDD:409353
Ig strand F 2821..2826 CDD:409353
PLAC 2851..2883 CDD:462560
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226 6/24 (25%)
Kunitz_bikunin_1-like 229..282 CDD:438639 21/52 (40%)
Kunitz_bikunin_2-like 284..338 CDD:438640 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.