DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ppn and AMBP

DIOPT Version :9

Sequence 1:	NP_788752.2	Gene:	Ppn / 43872	FlyBaseID:	FBgn0003137	Length:	2898	Species:	Drosophila melanogaster
Sequence 2:	NP_001624.1	Gene:	AMBP / 259	HGNCID:	453	Length:	352	Species:	Homo sapiens

Alignment Length:	142	Identity:	54/142 - (38%)
Similarity:	67/142 - (47%)	Gaps:	15/142 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly  2044 EEECSARCSVNIDIRIGADPVEHDTSK---CFLAFEPGNCYNNVTRWFYNSAEGLCDEFVYTGCG 2105
            |||.|.          |...|...|.|   |.|.:..|.|....:|:|||.....|:.|.|.||.
Human   211 EEEGSG----------GGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCM 265

  Fly  2106 GNANNYATEEECQNECNDAQTTCALPPVRGRCSDLSRRWYFDERSGECHEFEFTGCRGNRNNFVS 2170
            ||.||:.||:||...|... ..|.||.|||.|....:.|.||...|:|..|.:.||:||.|.|.|
Human   266 GNGNNFVTEKECLQTCRTV-AACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYS 329

  Fly  2171 QSDCLNFCIGEP 2182
            :.:|..:| |.|
Human   330 EKECREYC-GVP 340

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ppn	NP_788752.2	TSP1	60..111	CDD:214559
		ADAM_spacer1	214..329	CDD:283607
		TSP1	468..521	CDD:214559
		TSP_1	645..693	CDD:278517
		Kunitz_BPTI	1611..1663	CDD:278443
		Kunitz_BPTI	1670..1721	CDD:278443
		Kunitz_BPTI	1729..1781	CDD:278443
		Kunitz_BPTI	1789..1840	CDD:278443
		Kunitz_BPTI	1848..1899	CDD:278443
		KU	1920..1973	CDD:238057
		Kunitz_BPTI	2001..2051	CDD:278443	4/6 (67%)
		KU	2071..2121	CDD:238057	21/49 (43%)
		Kunitz_BPTI	2127..2178	CDD:278443	21/50 (42%)
		KU	2192..2245	CDD:238057
		KU	2251..2304	CDD:238057
		KU	2316..2372	CDD:238057
		WAP	2457..2497	CDD:278522
		Ig	2521..2610	CDD:299845
		IG_like	2530..2610	CDD:214653
		IG_like	2627..2703	CDD:214653
		Ig	2636..2701	CDD:143165
		IG_like	2766..2841	CDD:214653
		Ig	2768..2830	CDD:299845
		PLAC	2851..2883	CDD:285849
AMBP	NP_001624.1	Lipocalin	22..>48	CDD:328776
		Lipocalin	42..186	CDD:306552
		Glycopeptide (secretory piece)	206..226		6/24 (25%)
		KU	229..282	CDD:238057	21/52 (40%)
		Kunitz_BPTI	286..338	CDD:278443	22/52 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	60	1.000	Domainoid score	I10576
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.810