Sequence 1: | NP_788752.2 | Gene: | Ppn / 43872 | FlyBaseID: | FBgn0003137 | Length: | 2898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001342200.1 | Gene: | Tfpi / 21788 | MGIID: | 1095418 | Length: | 306 | Species: | Mus musculus |
Alignment Length: | 240 | Identity: | 76/240 - (31%) |
---|---|---|---|
Similarity: | 107/240 - (44%) | Gaps: | 43/240 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1849 CEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDRKPEPTTTTPATR 1913
Fly 1914 PQPSRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFETENDCQQRCLSQEPP 1978
Fly 1979 --APTP---------------------------PRAPAPTRQPD----PAPTVAQCSQPADPGQC 2010
Fly 2011 DKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARCSVNI 2055 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppn | NP_788752.2 | TSP1 | 60..111 | CDD:214559 | |
ADAM_spacer1 | 214..329 | CDD:283607 | |||
TSP1 | 468..521 | CDD:214559 | |||
TSP_1 | 645..693 | CDD:278517 | |||
Kunitz_BPTI | 1611..1663 | CDD:278443 | |||
Kunitz_BPTI | 1670..1721 | CDD:278443 | |||
Kunitz_BPTI | 1729..1781 | CDD:278443 | |||
Kunitz_BPTI | 1789..1840 | CDD:278443 | |||
Kunitz_BPTI | 1848..1899 | CDD:278443 | 20/49 (41%) | ||
KU | 1920..1973 | CDD:238057 | 18/52 (35%) | ||
Kunitz_BPTI | 2001..2051 | CDD:278443 | 22/49 (45%) | ||
KU | 2071..2121 | CDD:238057 | |||
Kunitz_BPTI | 2127..2178 | CDD:278443 | |||
KU | 2192..2245 | CDD:238057 | |||
KU | 2251..2304 | CDD:238057 | |||
KU | 2316..2372 | CDD:238057 | |||
WAP | 2457..2497 | CDD:278522 | |||
Ig | 2521..2610 | CDD:299845 | |||
IG_like | 2530..2610 | CDD:214653 | |||
IG_like | 2627..2703 | CDD:214653 | |||
Ig | 2636..2701 | CDD:143165 | |||
IG_like | 2766..2841 | CDD:214653 | |||
Ig | 2768..2830 | CDD:299845 | |||
PLAC | 2851..2883 | CDD:285849 | |||
Tfpi | NP_001342200.1 | KU | 48..101 | CDD:238057 | 20/50 (40%) |
Kunitz_BPTI | 120..171 | CDD:394972 | 17/50 (34%) | ||
Kunitz_BPTI | 224..276 | CDD:394972 | 22/51 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 60 | 1.000 | Domainoid score | I10536 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4295 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |