DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and mlt-11

DIOPT Version :10

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:NP_001256938.1 Gene:mlt-11 / 180352 WormBaseID:WBGene00012186 Length:3129 Species:Caenorhabditis elegans


Alignment Length:181 Identity:41/181 - (22%)
Similarity:65/181 - (35%) Gaps:44/181 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 KVFCDKGAERKTRDEERRAAKRKMTATGRKKLDELYHPVVDRSEFYGMSDLMKPPVLFSPS---- 453
            ::...:.|.|....||.|.:    |:..|.:..|: |.:.:|.....:::.||......|.    
 Worm    48 QIIAPRSAPRIQGTEEARGS----TSRKRSRAAEM-HNLAERRRREKINERMKTLQQLIPRCNKS 107

  Fly   454 ------ED-IDKLTSMDM---QFYGHDADSLSGTSDNVKSPFLLH--ANKPATPTLKFHNHFPPD 506
                  || |:.:.|::|   ||..|.|..::.....:..|...|  ...|:.|        ||.
 Worm   108 TKVSMLEDVIEYVKSLEMQINQFMPHMAMGMNQPPAYIPFPSQAHMAGVGPSYP--------PPR 164

  Fly   507 VP---TDKKDPSIIMDGSMVTNSMVDFTPQIK-----------RQRMTPPL 543
            .|   ....|||.:...|...|. |...||:.           :|.:.|||
 Worm   165 YPFPNIQTFDPSRVWLQSPQPNP-VSNQPQMNPYGQFVGHHQMQQSLPPPL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559
ADAMTS_CR_3 116..213 CDD:437068
ADAMTS_spacer1 222..329 CDD:461796
TSP1_ADAMTS 347..396 CDD:465950 0/2 (0%)
TSP1_ADAMTS 400..457 CDD:465950 15/67 (22%)
TSP1_ADAMTS 465..520 CDD:465950 14/59 (24%)
TSP1_ADAMTS 580..632 CDD:465950
TSP1_ADAMTS 643..693 CDD:465950
MSCRAMM_ClfA <1049..1262 CDD:468110
Kunitz_papilin_lacunin-like 1612..1663 CDD:438681
Kunitz_BPTI 1670..1721 CDD:425421
Kunitz-type 1730..1780 CDD:438633
Kunitz_BPTI 1789..1840 CDD:425421
Kunitz_papilin_mig6-like 1849..1899 CDD:438679
Kunitz_papilin_mig6-like 1922..1972 CDD:438679
Kunitz_papilin_mig6-like 2001..2051 CDD:438679
Kunitz-type 2071..2121 CDD:438633
Kunitz_BPTI 2127..2178 CDD:425421
Kunitz_BPTI 2193..2245 CDD:425421
Kunitz_BPTI 2252..2303 CDD:425421
Kunitz_BPTI 2317..2372 CDD:425421
WAP 2455..2497 CDD:459672
Ig 2530..2610 CDD:472250
Ig strand B 2539..2543 CDD:409353
Ig strand C 2552..2556 CDD:409353
Ig strand E 2576..2579 CDD:409353
Ig strand F 2589..2594 CDD:409353
Ig strand G 2603..2606 CDD:409353
IG_like 2627..2703 CDD:214653
Ig strand B 2636..2640 CDD:409353
Ig strand C 2649..2653 CDD:409353
Ig strand E 2670..2674 CDD:409353
Ig strand F 2684..2689 CDD:409353
Ig strand G 2697..2700 CDD:409353
I-set 2766..2845 CDD:400151
Ig strand B 2771..2775 CDD:409353
Ig strand C 2784..2788 CDD:409353
Ig strand F 2821..2826 CDD:409353
PLAC 2851..2883 CDD:462560
mlt-11NP_001256938.1 TY <361..409 CDD:238114
Kunitz-type 429..473 CDD:438633
Kunitz_BPTI 538..590 CDD:425421
Kunitz-type 737..787 CDD:438633
Kunitz_BPTI 803..855 CDD:425421
Kunitz_BPTI 865..917 CDD:425421
Kunitz-type 1083..1133 CDD:438633
Kunitz_BPTI 2176..2228 CDD:425421
Kunitz_ixolaris_2 2241..2291 CDD:438669
Kunitz_BPTI 2742..2793 CDD:425421
Lustrin_cystein 2910..2956 CDD:464222
Kunitz_BPTI 3070..3128 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.