powered by:
Protein Alignment Ppn and CG43165
DIOPT Version :9
Sequence 1: | NP_788752.2 |
Gene: | Ppn / 43872 |
FlyBaseID: | FBgn0003137 |
Length: | 2898 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001245858.1 |
Gene: | CG43165 / 12798550 |
FlyBaseID: | FBgn0262721 |
Length: | 95 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 25/68 - (36%) |
Similarity: | 36/68 - (52%) |
Gaps: | 8/68 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 1719 GTCAASENLPTCEQ-PVESG----PCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNY 1778
|.|... |.|.| |..:| .|||:||::.|....::|:.|.||||.||.|::.|...|:.
Fly 17 GLCLKD---PICGQPPAVNGNDFIKCAGSFEKFSYYPHINVCQKFEYGGCFGNDNSFNTLEKCHK 78
Fly 1779 NCR 1781
.|:
Fly 79 KCK 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.