DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and Cd22

DIOPT Version :9

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:XP_006539552.1 Gene:Cd22 / 12483 MGIID:88322 Length:879 Species:Mus musculus


Alignment Length:498 Identity:100/498 - (20%)
Similarity:145/498 - (29%) Gaps:187/498 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  2478 DCRGDNKC-CSDGCGQLCVHPARPTQPPRTQAPVVSYPGDARAALEPKEAHELDVQTAIGGIAVL 2541
            |.||..:| .|:..|        |.:....:..|...|..:|..:.|..|.|       |....|
Mouse   334 DMRGKYRCQASN
DIG--------PGESEEVELTVHYAPEPSRVHIYPSPAEE-------GQSVEL 383

  Fly  2542 RCFATGNP-APNITW--SLKNLVINTNKGRYVLTANGDLTIVQVRQTDDGTYVCVASNGLGE-PV 2602
            .|.:..:| |.|.||  :.|.:..:|.:         .|.|.:|.....|.|.|:|.|.||. .:
Mouse   384 ICESLASPSATNYTWYHNRKPIPGDTQE---------KLRIPKVSPWHAGNYSCLAENRLGHGKI 439

  Fly  2603 RREVALQV--------TEPVSQPAYIYGDKNVTQIVELN--------------------RPAVIR 2639
            .:|..|.|        |...|....:.|| :||.:...|                    :|.|:|
Mouse   440 DQEAKLDVHYAPKAVTTVIQSFTPILEGD-SVTLVCRYNSSNPDVTSYRWNPQGSGSVLKPGVLR 503

  Fly  2640 ------------CPAGGFPEPHVSWW--------------------------RNGQ--------- 2657
                        |.|..    |...|                          |.||         
Mouse   504 IQKVTWDSMPVSCAACN----HKCSWALPVILNVHYAPRDVKVLKVSPASEIRAGQRVLLQCDFA 564

  Fly  2658 --------MFGLKN-NLMARDYSLVFNSIQLSDLGLYTCEVYNQRRPVSLRVTLKAVGPVRPLSP 2713
                    .|..|| :|:.....|.|.|:...|.|.|.|.|.|     |:..||.....::.|  
Mouse   565 ESNPAEVRFFWKKNGSLVQEGRYLSFGSVSPEDSGNYNCMVNN-----SIGETLSQAWNLQVL-- 622

  Fly  2714 EEEQYMQYVLNPATRPVTQRPSYPYRPTRPAYVPEPTVNVHAVLALEPKNSYTPGSTIVMSCSVQ 2778
                                    |.|.|            ..:::.|.:....|....:||...
Mouse   623 ------------------------YAPRR------------LRVSISPGDHVMEGKKATLSCESD 651

  Fly  2779 GYPE-PNVTWIKDDVPLYNNERVQITYQPHRLVLSDVTSADSGKYTCRASNAYTYANGEANVSIQ 2842
            ..|. ...||       :::....:.....:|.|..:....:|.|.|:.:|.  ...||:..|..
Mouse   652 ANPPISQYTW-------FDSSGQDLHSSGQKLRLEPLEVQHTGSYRCKGTNG--IGTGESPPSTL 707

  Fly  2843 SVVPVSPECVDNPYFANCKLIVKGRYCSNPYYTQFCCRSCTLA 2885
            :|. .|||.:.       |.:..|        ..||...|.||
Mouse   708 TVY-YSPETIG-------KRVALG--------LGFCLTICILA 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559
ADAM_spacer1 214..329 CDD:283607
TSP1 468..521 CDD:214559
TSP_1 645..693 CDD:278517
Kunitz_BPTI 1611..1663 CDD:278443
Kunitz_BPTI 1670..1721 CDD:278443
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522 6/19 (32%)
Ig 2521..2610 CDD:299845 25/92 (27%)
IG_like 2530..2610 CDD:214653 22/83 (27%)
IG_like 2627..2703 CDD:214653 27/151 (18%)
Ig 2636..2701 CDD:143165 23/120 (19%)
IG_like 2766..2841 CDD:214653 14/75 (19%)
Ig 2768..2830 CDD:299845 12/62 (19%)
PLAC 2851..2883 CDD:285849 4/31 (13%)
Cd22XP_006539552.1 Ig 37..145 CDD:386229
Ig 164..250 CDD:386229
Ig_3 271..345 CDD:372822 4/10 (40%)
IGc2 377..435 CDD:197706 19/73 (26%)
IGc2 554..610 CDD:197706 16/60 (27%)
Ig_3 629..695 CDD:372822 12/72 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.