DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and lrig1

DIOPT Version :10

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:XP_002938412.1 Gene:lrig1 / 100491453 XenbaseID:XB-GENE-494193 Length:1043 Species:Xenopus tropicalis


Alignment Length:373 Identity:87/373 - (23%)
Similarity:143/373 - (38%) Gaps:81/373 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  2494 CVHPARPTQPPRTQAPVVSYPGDARAALEPKEAHELDVQT--AIGGIAV-LRC-FATGNPAP-NI 2553
            |.||...........|..|:..|..    ||....:..:|  |:.|.|: ..| .|:.:|:| ..
 Frog   455 CAHPGSLNNTSIFSVPPRSFVCDDL----PKPQIRVQPETTMAVLGKAIRFTCSAASSSPSPMTF 515

  Fly  2554 TWSLKNLVINTNKGRYVLTA---NGDL----TIVQVRQ---TDDGTYVCVASNGLGEPVRREVAL 2608
            .|...|.:::..:.....:.   .|::    ||:.:|.   ..:|.|.|:.:|..|.....:..|
 Frog   516 AWKKDNEILHNAEVENFASGTEREGEVTEYTTILHLRNLTFAHEGRYQCIITNDFGPSYSSKARL 580

  Fly  2609 QVTEPVSQPAYIYGDKNVTQIVELNRPAVIRCPAGGFPEPHVSWWRNGQMFGL--------KNNL 2665
            .|.   ..|::|...::.|  :.....|.:.|.|.|.|.|.::|.::|   |.        :.::
 Frog   581 TVN---VLPSFIKTPRDST--IRAGTRARLECAADGHPTPEIAWQKDG---GTDFPAARERRMHV 637

  Fly  2666 MARDYSLVFNSIQLSDLGLYTCEVYNQRRPVSLRVTLKAVGPVRPLSPEEEQYMQYVLNPATRPV 2730
            |..|.......:::.|:|:|:|...|....||...||..:            .|.::::|     
 Frog   638 MPDDDVFFIMDVKIEDMGVYSCTAQNSAGSVSANATLTVL------------EMPFLVHP----- 685

  Fly  2731 TQRPSYPYRPTRPAYVPEPTVNVHAVLALEPKNSYTPGSTIVMSCSVQGYPEPNVTWIKDDVPLY 2795
                                        ||.:...| |:|:.:.|...|.|.|.:||:|.|.||.
 Frog   686 ----------------------------LEDRVVST-GATLALQCKASGSPPPRITWLKGDEPLV 721

  Fly  2796 NNERVQITYQPHRLVLSDVTSADSGKYTCRASNAYTYANGEANVSIQS 2843
            ..||...|.....|::..|.|.|:|||||..||........::|||.|
 Frog   722 MTERHHYTPGNQLLIIRQVMSEDAGKYTCEMSNTLGTERAYSHVSIAS 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559
ADAMTS_CR_3 116..213 CDD:437068
ADAMTS_spacer1 222..329 CDD:461796
TSP1_ADAMTS 347..396 CDD:465950
TSP1_ADAMTS 400..457 CDD:465950
TSP1_ADAMTS 465..520 CDD:465950
TSP1_ADAMTS 580..632 CDD:465950
TSP1_ADAMTS 643..693 CDD:465950
MSCRAMM_ClfA <1049..1262 CDD:468110
Kunitz_papilin_lacunin-like 1612..1663 CDD:438681
Kunitz_BPTI 1670..1721 CDD:425421
Kunitz-type 1730..1780 CDD:438633
Kunitz_BPTI 1789..1840 CDD:425421
Kunitz_papilin_mig6-like 1849..1899 CDD:438679
Kunitz_papilin_mig6-like 1922..1972 CDD:438679
Kunitz_papilin_mig6-like 2001..2051 CDD:438679
Kunitz-type 2071..2121 CDD:438633
Kunitz_BPTI 2127..2178 CDD:425421
Kunitz_BPTI 2193..2245 CDD:425421
Kunitz_BPTI 2252..2303 CDD:425421
Kunitz_BPTI 2317..2372 CDD:425421
WAP 2455..2497 CDD:459672 1/2 (50%)
Ig 2530..2610 CDD:472250 20/94 (21%)
Ig strand B 2539..2543 CDD:409353 1/4 (25%)
Ig strand C 2552..2556 CDD:409353 0/3 (0%)
Ig strand E 2576..2579 CDD:409353 0/6 (0%)
Ig strand F 2589..2594 CDD:409353 2/4 (50%)
Ig strand G 2603..2606 CDD:409353 0/2 (0%)
IG_like 2627..2703 CDD:214653 20/83 (24%)
Ig strand B 2636..2640 CDD:409353 1/3 (33%)
Ig strand C 2649..2653 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 0/3 (0%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 1/2 (50%)
I-set 2766..2845 CDD:400151 31/78 (40%)
Ig strand B 2771..2775 CDD:409353 0/3 (0%)
Ig strand C 2784..2788 CDD:409353 1/3 (33%)
Ig strand F 2821..2826 CDD:409353 4/4 (100%)
PLAC 2851..2883 CDD:462560
lrig1XP_002938412.1 LRR <39..362 CDD:443914
leucine-rich repeat 57..80 CDD:275378
leucine-rich repeat 104..127 CDD:275380
leucine-rich repeat 128..151 CDD:275380
leucine-rich repeat 152..199 CDD:275380
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 224..247 CDD:275380
leucine-rich repeat 248..295 CDD:275380
leucine-rich repeat 272..292 CDD:275380
leucine-rich repeat 296..319 CDD:275380
leucine-rich repeat 320..343 CDD:275380
LRR_8 343..405 CDD:404697
leucine-rich repeat 344..370 CDD:275380
leucine-rich repeat 371..394 CDD:275380
leucine-rich repeat 395..413 CDD:275380
LRRCT 429..477 CDD:214507 5/21 (24%)
leucine-rich repeat 445..471 CDD:275380 3/15 (20%)
Ig_3 481..568 CDD:464046 18/86 (21%)
IgI_LRIG1-like 587..677 CDD:409420 22/94 (23%)
Ig strand A 587..590 CDD:409420 0/2 (0%)
Ig strand A' 594..598 CDD:409420 1/5 (20%)
Ig strand B 601..610 CDD:409420 2/8 (25%)
Ig strand C 616..621 CDD:409420 1/4 (25%)
Ig strand C' 624..626 CDD:409420 1/1 (100%)
Ig strand D 634..638 CDD:409420 0/3 (0%)
Ig strand E 642..649 CDD:409420 0/6 (0%)
Ig strand F 655..663 CDD:409420 3/7 (43%)
Ig strand G 666..677 CDD:409420 4/10 (40%)
I-set 680..759 CDD:400151 30/112 (27%)
Ig strand C 710..714 CDD:409353 1/3 (33%)
Ig strand E 733..737 CDD:409353 1/3 (33%)
Ig strand F 747..752 CDD:409353 4/4 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.