DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and XB995277

DIOPT Version :9

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:XP_031760531.1 Gene:XB995277 / 100487633 XenbaseID:XB-GENE-995278 Length:488 Species:Xenopus tropicalis


Alignment Length:448 Identity:124/448 - (27%)
Similarity:198/448 - (44%) Gaps:78/448 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVAFIVLASIH-DSQSRFPGLRQKRQYGANMYLPESSVTPGGEGNDPDEWTPWSSPSDCSRTCGG 75
            |..|.:...|| |..:         |...:|| ....:|...:|    :||.|:|.:..|.|||.
 Frog     8 LAVFFITFFIHADCDT---------QVTDSMY-QSGGITRPSKG----QWTAWASWTSSSSTCGN 58

  Fly    76 GVSYQTRECLR--RDDRGEAVCSGGSRRYFSCNTQDCPEEESDFRAQQCSRFDRQQFDGV--FYE 136
            ||:.:||.|||  |.||    |:|..|:|.||.:..|||:...||..||:.::.:...|.  .|:
 Frog    59 GVAVRTRRCLRVTRMDR----CAGEQRQYRSCQSGICPEDALPFRDLQCALYNYRPIPGSQRGYK 119

  Fly   137 WVPYTNAPNPCELNCMPKGERFYYRQREKVVDGTRCNDKDLDVCVNGECMPVGCDMMLGSDAKED 201
            |||:..||..|.|||:..|:.||| ...:|:|||.|.......|:||:|:...|:.:..|:..::
 Frog   120 WVPFYGAPTACHLNCLAVGQNFYY-TFGRVLDGTSCGPNSNGTCINGQCLKADCNGIFTSEVSKE 183

  Fly   202 KCRKCGGDGSTCKTIRNTITTKDLAP-------GYNDLLLLPEGATNIRIEETVPSSNYLACRNH 259
            .|.||....:||..|:...    |||       ||.::..:|.||:.|::.:  .|.|.||..:.
 Frog   184 SCGKCQEQQNTCVLIQRVY----LAPFPSSGYFGYKNVTRIPAGASQIKVMD--ESRNILALMDS 242

  Fly   260 SGHYYLNGDWRIDFPRPMFFANSWWNYQRKPMGFAAPDQLTCSGPISESLFIVMLVQEKNISLDY 324
            :|||.:||||.:.:......|.:..:|.|..   .:.:.|...||.:|.|::.:|.||.|..:.|
 Frog   243 NGHYVINGDWVVSWSGIYKVAGTEVHYIRNS---ESHEVLEADGPTNEDLYVQVLFQENNPGITY 304

  Fly   325 EYSIPESL-------------SHSQQDTHTWTHHQFNACSASCGGGSQSRKVTCNNRITLAEVNP 376
            ::.:|:.|             ....:|.::|.       :.:..|..:|...|...:..|.....
 Frog   305 QFWLPKDLYDNYKREPHLSWQQSENEDLNSWV-------NKTTSGNGESHLGTAQGKEVLTVSRK 362

  Fly   377 SLCDQKSKPVEEQACGTEPCAPHWVEGEWSKCSKGCGSDGFQNRSITCERISSSGEHT 434
            ..|.:...|                :|:..:..:.|.||...:..:...||  .|:.|
 Frog   363 GQCRRCKTP----------------KGKSQRIKQYCQSDFVIHAKVLGRRI--IGQET 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559 24/52 (46%)
ADAM_spacer1 214..329 CDD:283607 34/121 (28%)
TSP1 468..521 CDD:214559
TSP_1 645..693 CDD:278517
Kunitz_BPTI 1611..1663 CDD:278443
Kunitz_BPTI 1670..1721 CDD:278443
Kunitz_BPTI 1729..1781 CDD:278443
Kunitz_BPTI 1789..1840 CDD:278443
Kunitz_BPTI 1848..1899 CDD:278443
KU 1920..1973 CDD:238057
Kunitz_BPTI 2001..2051 CDD:278443
KU 2071..2121 CDD:238057
Kunitz_BPTI 2127..2178 CDD:278443
KU 2192..2245 CDD:238057
KU 2251..2304 CDD:238057
KU 2316..2372 CDD:238057
WAP 2457..2497 CDD:278522
Ig 2521..2610 CDD:299845
IG_like 2530..2610 CDD:214653
IG_like 2627..2703 CDD:214653
Ig 2636..2701 CDD:143165
IG_like 2766..2841 CDD:214653
Ig 2768..2830 CDD:299845
PLAC 2851..2883 CDD:285849
XB995277XP_031760531.1 TSP1 <56..92 CDD:214559 18/39 (46%)
ADAM_CR_2 99..168 CDD:407643 26/69 (38%)
ADAM_spacer1 207..309 CDD:368694 30/106 (28%)
NTR 379..479 CDD:396359 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.