DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppn and lrig3

DIOPT Version :10

Sequence 1:NP_788752.2 Gene:Ppn / 43872 FlyBaseID:FBgn0003137 Length:2898 Species:Drosophila melanogaster
Sequence 2:XP_002940426.3 Gene:lrig3 / 100151727 XenbaseID:XB-GENE-1219309 Length:1109 Species:Xenopus tropicalis


Alignment Length:355 Identity:85/355 - (23%)
Similarity:139/355 - (39%) Gaps:80/355 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  2522 EPKEAHELDVQTAIGG--IAVLRCFATGNPAP-NITWSLKNLVINTNK-GRYV-LTANGD----- 2576
            :|:...:.:.|:||.|  :..:...|:.:.:| ...|...|.:::.:: ..|. |.|.|.     
 Frog   493 KPQITVQPETQSAIKGSNVTFICSAASSSESPMTFAWKKDNELLHDSEIENYAHLRAQGGEVMEY 557

  Fly  2577 LTIVQVRQTD---DGTYVCVASNGLGEPVRREVALQVTEPVSQPAYIYGDKNVTQIVELNRPAVI 2638
            .||:::|..:   :|.|.||.||..|.....:..|.|.   ..|.:.....::|  :.....|.:
 Frog   558 TTILRLRNVEFINEGKYQCVISNHFGPTYSVKAKLTVN---MLPLFTKMPMDLT--IRAGSTARL 617

  Fly  2639 RCPAGGFPEPHVSWWRNGQMFGL--------KNNLMARDYSLVFNSIQLSDLGLYTCEVYNQRRP 2695
            .|.|.|.|.|.::|.:||   |.        :.::|..|......:::..|:|:|:|...|....
 Frog   618 ECAAVGHPTPQIAWQKNG---GTDFPAARERRMHVMPEDDVFFIVNVKTEDIGVYSCTAQNSAGS 679

  Fly  2696 VSLRVTLKAVGPVRPLSPEEEQYMQYVLNPATRPVTQRPSYPYRPTRPAYVPEPTVNVHAVLALE 2760
            :|...||..:        |...::        ||:..|.:                         
 Frog   680 ISANATLTVL--------ETPSFL--------RPLVDRTA------------------------- 703

  Fly  2761 PKNSYTPGSTIVMSCSVQGYPEPNVTWIKDDVPLYNNERVQITYQPHRLVLSDVTSADSGKYTCR 2825
                 :.|.|.|:.|...|.|.|.|.|.|||.||...||.........|::.|....|:|||||.
 Frog   704 -----SKGETTVLQCIAGGSPTPKVNWTKDDSPLVVTERHFFAAGNQHLIIVDTDLEDAGKYTCE 763

  Fly  2826 ASNAYTYANGEANVSIQSVVPVSPECVDNP 2855
            .||......|..::   ||:| :|.| |:|
 Frog   764 VSNILGTERGNIHL---SVLP-NPTC-DSP 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpnNP_788752.2 TSP1 60..111 CDD:214559
ADAMTS_CR_3 116..213 CDD:437068
ADAMTS_spacer1 222..329 CDD:461796
TSP1_ADAMTS 347..396 CDD:465950
TSP1_ADAMTS 400..457 CDD:465950
TSP1_ADAMTS 465..520 CDD:465950
TSP1_ADAMTS 580..632 CDD:465950
TSP1_ADAMTS 643..693 CDD:465950
MSCRAMM_ClfA <1049..1262 CDD:468110
Kunitz_papilin_lacunin-like 1612..1663 CDD:438681
Kunitz_BPTI 1670..1721 CDD:425421
Kunitz-type 1730..1780 CDD:438633
Kunitz_BPTI 1789..1840 CDD:425421
Kunitz_papilin_mig6-like 1849..1899 CDD:438679
Kunitz_papilin_mig6-like 1922..1972 CDD:438679
Kunitz_papilin_mig6-like 2001..2051 CDD:438679
Kunitz-type 2071..2121 CDD:438633
Kunitz_BPTI 2127..2178 CDD:425421
Kunitz_BPTI 2193..2245 CDD:425421
Kunitz_BPTI 2252..2303 CDD:425421
Kunitz_BPTI 2317..2372 CDD:425421
WAP 2455..2497 CDD:459672
Ig 2530..2610 CDD:472250 23/92 (25%)
Ig strand B 2539..2543 CDD:409353 0/3 (0%)
Ig strand C 2552..2556 CDD:409353 0/3 (0%)
Ig strand E 2576..2579 CDD:409353 0/7 (0%)
Ig strand F 2589..2594 CDD:409353 2/4 (50%)
Ig strand G 2603..2606 CDD:409353 0/2 (0%)
IG_like 2627..2703 CDD:214653 20/83 (24%)
Ig strand B 2636..2640 CDD:409353 1/3 (33%)
Ig strand C 2649..2653 CDD:409353 0/3 (0%)
Ig strand E 2670..2674 CDD:409353 0/3 (0%)
Ig strand F 2684..2689 CDD:409353 2/4 (50%)
Ig strand G 2697..2700 CDD:409353 1/2 (50%)
I-set 2766..2845 CDD:400151 28/78 (36%)
Ig strand B 2771..2775 CDD:409353 1/3 (33%)
Ig strand C 2784..2788 CDD:409353 1/3 (33%)
Ig strand F 2821..2826 CDD:409353 4/4 (100%)
PLAC 2851..2883 CDD:462560 3/5 (60%)
lrig3XP_002940426.3 LRRNT 40..67 CDD:214470
leucine-rich repeat 52..69 CDD:275380
LRR 65..442 CDD:443914
leucine-rich repeat 73..93 CDD:275380
leucine-rich repeat 94..140 CDD:275380
leucine-rich repeat 141..163 CDD:275380
leucine-rich repeat 164..187 CDD:275380
leucine-rich repeat 189..211 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..331 CDD:275380
leucine-rich repeat 332..355 CDD:275380
leucine-rich repeat 356..380 CDD:275380
leucine-rich repeat 383..406 CDD:275380
leucine-rich repeat 407..428 CDD:275380
PCC 411..>489 CDD:188093
Ig_3 493..580 CDD:464046 20/86 (23%)
IgI_LRIG1-like 600..689 CDD:409420 21/93 (23%)
Ig strand A' 606..610 CDD:409420 1/5 (20%)
Ig strand B 613..622 CDD:409420 2/8 (25%)
Ig strand C 628..633 CDD:409420 1/4 (25%)
Ig strand C' 636..638 CDD:409420 1/1 (100%)
Ig strand D 646..650 CDD:409420 0/3 (0%)
Ig strand E 654..661 CDD:409420 0/6 (0%)
Ig strand F 667..675 CDD:409420 3/7 (43%)
Ig strand G 678..689 CDD:409420 3/10 (30%)
I-set 692..779 CDD:400151 30/127 (24%)
Ig strand B 709..713 CDD:409353 1/3 (33%)
Ig strand C 722..726 CDD:409353 1/3 (33%)
Ig strand E 743..749 CDD:409353 1/5 (20%)
Ig strand F 759..764 CDD:409353 4/4 (100%)
Ig strand G 772..775 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.